Clone BS33163 Report

Search the DGRC for BS33163

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptObp56e-RB
Protein status:BS33163.pep: gold
Sequenced Size:428

Clone Sequence Records

BS33163.complete Sequence

428 bp assembled on 2014-01-22

GenBank Submission: KX800423

> BS33163.complete
GAAGTTATCAGTCGACATGAAAGTATTCTTTGTGTTTGCCGCCCTTGCAG
CTCTATCTTTGGCATCTGCCGGGCTAACTGATTCCCAAAAGGCTGAGGCA
AAGCAGAGAGCCAAGGCCTGCGTCAAACAGGAGGGAATCACGAAGGAGCA
AGCTATTGCCCTGCGGTCTGGAAACTTTGCAGACTCCGATCCAAAGGTAA
AGTGCTTCGCCAACTGCTTCCTGGAGCAGACCGGCCTGGTGGCCAATGGG
CAGATAAAACCTGACGTGGTTTTGGCCAAACTAGGTCCCATCGCCGGCGA
AGCCAATGTCAAGGAGGTGCAGGCCAAGTGTGACTCGACCAAGGGAGCCG
ACAAGTGCGACACTAGCTATCTGCTGTACAAGTGCTACTACGAAAACCAC
GCCCAATTCTAAAAGCTTTCTAGACCAT

BS33163.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RB 396 CG8462-PB 1..396 17..412 1980 100 Plus
Obp56e-RA 399 CG8462-PA 1..399 17..412 1915 99.2 Plus
Obp56d-RB 396 CG11218-PB 112..396 128..412 255 72.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RB 529 CG8462-RB 52..448 16..412 1985 100 Plus
Obp56e-RA 532 CG8462-RA 52..451 16..412 1920 99.2 Plus
Obp56d-RB 922 CG11218-RB 277..561 128..412 255 72.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19712510..19712851 71..412 1710 100 Plus
2R 25286936 2R 19712396..19712451 16..71 280 100 Plus
2R 25286936 2R 19703285..19703569 412..128 255 72.6 Minus
Blast to na_te.dros performed on 2014-11-28 14:53:36 has no hits.

BS33163.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:28 Download gff for BS33163.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RB 53..446 17..410 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:55 Download gff for BS33163.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RB 53..446 17..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:55 Download gff for BS33163.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19712397..19712450 17..70 100 -> Plus
2R 19712510..19712849 71..410 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:28 Download gff for BS33163.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15599902..15599955 17..70 100 -> Plus
arm_2R 15600015..15600354 71..410 100   Plus

BS33163.pep Sequence

Translation from 16 to 411

> BS33163.pep
MKVFFVFAALAALSLASAGLTDSQKAEAKQRAKACVKQEGITKEQAIALR
SGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKE
VQAKCDSTKGADKCDTSYLLYKCYYENHAQF*

BS33163.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-PB 131 CG8462-PB 1..131 1..131 671 100 Plus
Obp56e-PA 132 CG8462-PA 1..132 1..131 659 99.2 Plus
Obp56d-PB 131 CG11218-PB 1..129 1..129 448 64.3 Plus
Obp56d-PA 131 CG11218-PA 1..129 1..129 448 64.3 Plus
Obp56a-PA 139 CG11797-PA 1..128 1..124 234 36.7 Plus