BS33188.complete Sequence
311 bp assembled on 2014-01-22
GenBank Submission: KX805876
> BS33188.complete
GAAGTTATCAGTCGACATGCTTCACTCAAACTATCTTTTTCTGATCGGCG
GTTGCTGCCTGGTTTTCGCTGTCTCAGCGCAGATTCCCATCACGCCGCGA
CGTTGCCCGGCGAACGAGACTTTCCTGGCCTGTGGTCCCGATTGTCAAAC
GGAGTGCGCCACGCTAGGAAAGCCCTGTCTGGTCAGGCACATCCGATGTC
CAGATGGATGCTACTGCAACAAGGGCTTCGCGAGGAACGCCGCGGGCACG
TGCATCCCCCTTCGGCGGTGCAACGAAGGCGGCTACGGAAACTGAAAGCT
TTCTAGACCAT
BS33188.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:54:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42259-RB | 279 | CG42259-PB | 1..279 | 17..295 | 1395 | 100 | Plus |
CG42259-RA | 279 | CG42259-PA | 1..279 | 17..295 | 1395 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:54:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42259-RB | 486 | CG42259-RB | 37..316 | 17..296 | 1400 | 100 | Plus |
CG42259-RA | 711 | CG42259-RA | 262..541 | 17..296 | 1400 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:54:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 1046636..1046839 | 93..296 | 1020 | 100 | Plus |
X | 23542271 | X | 1046485..1046560 | 17..92 | 380 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:54:06 has no hits.
BS33188.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:41 Download gff for
BS33188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42259-RA | 262..539 | 17..294 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:08 Download gff for
BS33188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42259-RA | 262..539 | 17..294 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:08 Download gff for
BS33188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1046485..1046560 | 17..92 | 100 | -> | Plus |
X | 1046636..1046837 | 93..294 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:41 Download gff for
BS33188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 940518..940593 | 17..92 | 100 | -> | Plus |
arm_X | 940669..940870 | 93..294 | 100 | | Plus |
BS33188.pep Sequence
Translation from 16 to 294
> BS33188.pep
MLHSNYLFLIGGCCLVFAVSAQIPITPRRCPANETFLACGPDCQTECATL
GKPCLVRHIRCPDGCYCNKGFARNAAGTCIPLRRCNEGGYGN*
BS33188.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42259-PB | 92 | CG42259-PB | 1..92 | 1..92 | 530 | 100 | Plus |
CG42259-PA | 92 | CG42259-PA | 1..92 | 1..92 | 530 | 100 | Plus |