Clone BS33188 Report

Search the DGRC for BS33188

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG42259-RA
Protein status:BS33188.pep: full length peptide match
Sequenced Size:311

Clone Sequence Records

BS33188.complete Sequence

311 bp assembled on 2014-01-22

GenBank Submission: KX805876

> BS33188.complete
GAAGTTATCAGTCGACATGCTTCACTCAAACTATCTTTTTCTGATCGGCG
GTTGCTGCCTGGTTTTCGCTGTCTCAGCGCAGATTCCCATCACGCCGCGA
CGTTGCCCGGCGAACGAGACTTTCCTGGCCTGTGGTCCCGATTGTCAAAC
GGAGTGCGCCACGCTAGGAAAGCCCTGTCTGGTCAGGCACATCCGATGTC
CAGATGGATGCTACTGCAACAAGGGCTTCGCGAGGAACGCCGCGGGCACG
TGCATCCCCCTTCGGCGGTGCAACGAAGGCGGCTACGGAAACTGAAAGCT
TTCTAGACCAT

BS33188.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42259-RB 279 CG42259-PB 1..279 17..295 1395 100 Plus
CG42259-RA 279 CG42259-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42259-RB 486 CG42259-RB 37..316 17..296 1400 100 Plus
CG42259-RA 711 CG42259-RA 262..541 17..296 1400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1046636..1046839 93..296 1020 100 Plus
X 23542271 X 1046485..1046560 17..92 380 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:54:06 has no hits.

BS33188.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:41 Download gff for BS33188.complete
Subject Subject Range Query Range Percent Splice Strand
CG42259-RA 262..539 17..294 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:08 Download gff for BS33188.complete
Subject Subject Range Query Range Percent Splice Strand
CG42259-RA 262..539 17..294 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:08 Download gff for BS33188.complete
Subject Subject Range Query Range Percent Splice Strand
X 1046485..1046560 17..92 100 -> Plus
X 1046636..1046837 93..294 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:41 Download gff for BS33188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 940518..940593 17..92 100 -> Plus
arm_X 940669..940870 93..294 100   Plus

BS33188.pep Sequence

Translation from 16 to 294

> BS33188.pep
MLHSNYLFLIGGCCLVFAVSAQIPITPRRCPANETFLACGPDCQTECATL
GKPCLVRHIRCPDGCYCNKGFARNAAGTCIPLRRCNEGGYGN*

BS33188.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42259-PB 92 CG42259-PB 1..92 1..92 530 100 Plus
CG42259-PA 92 CG42259-PA 1..92 1..92 530 100 Plus