Clone BS33195 Report

Search the DGRC for BS33195

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG43188-RA
Protein status:BS33195.pep: full length peptide match
Sequenced Size:167

Clone Sequence Records

BS33195.complete Sequence

167 bp assembled on 2014-01-22

GenBank Submission: KX805842

> BS33195.complete
GAAGTTATCAGTCGACATGGTGTGGGATACTCAAGAGTGTAGCAATCAAG
ATGAGGATTTTGAACGGCCCAGCAGGACCCTGATTCTGGTAATCTTCACC
CTCGCCGTGTGCCTCAAGTTGTTCATCATTCTGCTGGAGATTATGTCCTG
AAAGCTTTCTAGACCAT

BS33195.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG43188-RA 135 CG43188-PA 1..135 17..151 675 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG43188-RA 795 CG43188-RA 53..187 17..151 675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11085638..11085772 17..151 675 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:53:58 has no hits.

BS33195.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:37 Download gff for BS33195.complete
Subject Subject Range Query Range Percent Splice Strand
CG43188-RA 53..186 17..150 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:05 Download gff for BS33195.complete
Subject Subject Range Query Range Percent Splice Strand
CG43188-RA 53..186 17..150 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:05 Download gff for BS33195.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11085638..11085771 17..150 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:37 Download gff for BS33195.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6973143..6973276 17..150 100   Plus

BS33195.pep Sequence

Translation from 16 to 150

> BS33195.pep
MVWDTQECSNQDEDFERPSRTLILVIFTLAVCLKLFIILLEIMS*

BS33195.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43188-PA 44 CG43188-PA 1..44 1..44 224 100 Plus