BS33195.complete Sequence
167 bp assembled on 2014-01-22
GenBank Submission: KX805842
> BS33195.complete
GAAGTTATCAGTCGACATGGTGTGGGATACTCAAGAGTGTAGCAATCAAG
ATGAGGATTTTGAACGGCCCAGCAGGACCCTGATTCTGGTAATCTTCACC
CTCGCCGTGTGCCTCAAGTTGTTCATCATTCTGCTGGAGATTATGTCCTG
AAAGCTTTCTAGACCAT
BS33195.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:53:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43188-RA | 135 | CG43188-PA | 1..135 | 17..151 | 675 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:54:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43188-RA | 795 | CG43188-RA | 53..187 | 17..151 | 675 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:53:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11085638..11085772 | 17..151 | 675 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:53:58 has no hits.
BS33195.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:37 Download gff for
BS33195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43188-RA | 53..186 | 17..150 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:05 Download gff for
BS33195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43188-RA | 53..186 | 17..150 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:05 Download gff for
BS33195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11085638..11085771 | 17..150 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:37 Download gff for
BS33195.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6973143..6973276 | 17..150 | 100 | | Plus |
BS33195.pep Sequence
Translation from 16 to 150
> BS33195.pep
MVWDTQECSNQDEDFERPSRTLILVIFTLAVCLKLFIILLEIMS*
BS33195.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43188-PA | 44 | CG43188-PA | 1..44 | 1..44 | 224 | 100 | Plus |