Clone BS33358 Report

Search the DGRC for BS33358

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:333
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG12643-RA
Protein status:BS33358.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS33358.complete Sequence

266 bp assembled on 2014-01-24

GenBank Submission: KX803905

> BS33358.complete
GAAGTTATCAGTCGACATGCCGTTCCCCATCCATCCGCCCAAGCAGATGC
CCTGCCCCCACTGGCAGCACTTCCCCATCAGTCCCGTGGACAGTAAGCCG
AATCCATTCGATTCCGTCGGCGGAGCGGCAGCAGCGGCCACCCAGGTCAA
CATAGGGGTTAACAAGCCACCGGAGCCGGTATCCTATCGCTATTGTTTGC
AGTGCAAGAACTCCGGCAAGGAGCCAATAAACCCCGCCGACAGGGAGTAG
AAGCTTTCTAGACCAT

BS33358.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12643-RA 234 CG12643-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12643-RA 1031 CG12643-RA 190..423 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10264841..10265074 250..17 1170 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:55:04 has no hits.

BS33358.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-24 09:49:24 Download gff for BS33358.complete
Subject Subject Range Query Range Percent Splice Strand
CG12643-RA 190..423 17..250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:38 Download gff for BS33358.complete
Subject Subject Range Query Range Percent Splice Strand
CG12643-RA 190..423 17..250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:38 Download gff for BS33358.complete
Subject Subject Range Query Range Percent Splice Strand
X 10264841..10265074 17..250 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-24 09:49:24 Download gff for BS33358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10158874..10159107 17..250 100   Minus

BS33358.pep Sequence

Translation from 16 to 249

> BS33358.pep
MPFPIHPPKQMPCPHWQHFPISPVDSKPNPFDSVGGAAAAATQVNIGVNK
PPEPVSYRYCLQCKNSGKEPINPADRE*

BS33358.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG12643-PA 77 CG12643-PA 1..77 1..77 440 100 Plus