BS33360.complete Sequence
176 bp assembled on 2014-01-24
GenBank Submission: KX806252
> BS33360.complete
GAAGTTATCAGTCGACATGCTGCGCGATATCTTTCTGTATTTAGTTCTAA
TCGTTTTATTTTGCTTCATTTTCATGGCGCAGTTAATCGTCAACGTTTAC
GCCTTCCAGCGCCAGCCGTCGCCCAACAAAGCGGAGCGCAATGAAATTAT
ATTTGTCTAGAAGCTTTCTAGACCAT
BS33360.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:55:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34155-RA | 144 | CG34155-PA | 1..144 | 17..160 | 720 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:55:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34155-RA | 2619 | CG34155-RA | 413..558 | 17..162 | 730 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:55:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 30556615..30556760 | 162..17 | 730 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:55:07 has no hits.
BS33360.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-24 09:49:25 Download gff for
BS33360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34155-RA | 413..556 | 17..160 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:40 Download gff for
BS33360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34155-RA | 413..556 | 17..160 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:40 Download gff for
BS33360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30556617..30556760 | 17..160 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-24 09:49:25 Download gff for
BS33360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 26382339..26382482 | 17..160 | 100 | | Minus |
BS33360.pep Sequence
Translation from 16 to 159
> BS33360.pep
MLRDIFLYLVLIVLFCFIFMAQLIVNVYAFQRQPSPNKAERNEIIFV*
BS33360.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:56:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34155-PA | 47 | CG34155-PA | 1..47 | 1..47 | 236 | 100 | Plus |