Clone BS33360 Report

Search the DGRC for BS33360

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:333
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG34155-RA
Protein status:BS33360.pep: full length peptide match
Sequenced Size:176

Clone Sequence Records

BS33360.complete Sequence

176 bp assembled on 2014-01-24

GenBank Submission: KX806252

> BS33360.complete
GAAGTTATCAGTCGACATGCTGCGCGATATCTTTCTGTATTTAGTTCTAA
TCGTTTTATTTTGCTTCATTTTCATGGCGCAGTTAATCGTCAACGTTTAC
GCCTTCCAGCGCCAGCCGTCGCCCAACAAAGCGGAGCGCAATGAAATTAT
ATTTGTCTAGAAGCTTTCTAGACCAT

BS33360.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34155-RA 144 CG34155-PA 1..144 17..160 720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34155-RA 2619 CG34155-RA 413..558 17..162 730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30556615..30556760 162..17 730 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:55:07 has no hits.

BS33360.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-24 09:49:25 Download gff for BS33360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34155-RA 413..556 17..160 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:40 Download gff for BS33360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34155-RA 413..556 17..160 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:40 Download gff for BS33360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30556617..30556760 17..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-24 09:49:25 Download gff for BS33360.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26382339..26382482 17..160 100   Minus

BS33360.pep Sequence

Translation from 16 to 159

> BS33360.pep
MLRDIFLYLVLIVLFCFIFMAQLIVNVYAFQRQPSPNKAERNEIIFV*

BS33360.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34155-PA 47 CG34155-PA 1..47 1..47 236 100 Plus