Clone BS33362 Report

Search the DGRC for BS33362

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:333
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG42518-RA
Protein status:BS33362.pep: full length peptide match
Sequenced Size:290

Clone Sequence Records

BS33362.complete Sequence

290 bp assembled on 2014-01-24

GenBank Submission: KX800298

> BS33362.complete
GAAGTTATCAGTCGACATGGTGCTGCGACTGCTAATGCGCTACCTGGCCA
ACAACGAGCAGCTCATCCAGCGCATGGCGGAGAGCTATCCCATGAGACGC
GCTGCCCAGTTGGTCGTTTCCCTGATGTACCGCACAAAAGACTTGGCCCG
GGAGCAGGGACTGCACGAGATGACGCCAGAGCGTTTCAAATCCTTCGTTA
ACATGTTTAAGAACAACGTGCGCCAAGAGCTGGAGGGAGTGAAGAAGGAG
CTTAATAGCAAGAAAAAGAACTAGAAGCTTTCTAGACCAT

BS33362.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-RB 258 CG42518-PB 1..258 17..274 1290 100 Plus
CG42518-RA 258 CG42518-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
MED9-RC 871 CG42517-RC 526..783 17..274 1290 100 Plus
CG42518-RB 825 CG42518-RB 480..737 17..274 1290 100 Plus
CG42518-RA 871 CG42518-RA 526..783 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18167966..18168138 17..189 865 100 Plus
2R 25286936 2R 18168208..18168292 190..274 425 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:55:26 has no hits.

BS33362.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-24 09:49:32 Download gff for BS33362.complete
Subject Subject Range Query Range Percent Splice Strand
MED9-RC 526..768 17..259 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:48 Download gff for BS33362.complete
Subject Subject Range Query Range Percent Splice Strand
CG42518-RA 526..768 17..259 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:48 Download gff for BS33362.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18167966..18168138 17..189 100 -> Plus
2R 18168208..18168277 190..259 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-24 09:49:32 Download gff for BS33362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14055471..14055643 17..189 100 -> Plus
arm_2R 14055713..14055782 190..259 100   Plus

BS33362.pep Sequence

Translation from 16 to 273

> BS33362.pep
MVLRLLMRYLANNEQLIQRMAESYPMRRAAQLVVSLMYRTKDLAREQGLH
EMTPERFKSFVNMFKNNVRQELEGVKKELNSKKKN*

BS33362.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42518-PB 85 CG42518-PB 1..85 1..85 424 100 Plus
CG42518-PA 85 CG5134-PB 1..85 1..85 424 100 Plus