BS33366.complete Sequence
170 bp assembled on 2014-01-24
GenBank Submission: KX805995
> BS33366.complete
GAAGTTATCAGTCGACATGGAGCACATTCGATTTGTTGACAAAGTCTTTA
GAGCCCTGATCGCCGGCACCCTGCTGCTCCTGATGACCGCCATTTACCGG
GAGGACAACAACTCCGGATCCCACTACATCCATCCAAGACACGCCATGCA
GTAGAAGCTTTCTAGACCAT
BS33366.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:55:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42662-RC | 138 | CG42662-PC | 1..138 | 17..154 | 690 | 100 | Plus |
CG42662-RD | 138 | CG42662-PD | 1..138 | 17..154 | 690 | 100 | Plus |
CG42662-RB | 138 | CG42662-PB | 1..138 | 17..154 | 690 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:55:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42662-RC | 1695 | CG42662-RC | 1266..1405 | 15..154 | 700 | 100 | Plus |
CG42662-RD | 500 | CG42662-RD | 71..210 | 15..154 | 700 | 100 | Plus |
CG42662-RB | 2791 | CG42662-RB | 2362..2501 | 15..154 | 700 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:55:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 15699016..15699155 | 154..15 | 700 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:55:30 has no hits.
BS33366.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-24 09:49:34 Download gff for
BS33366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42662-RC | 1268..1405 | 17..154 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:50 Download gff for
BS33366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42662-RB | 2364..2501 | 17..154 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:50 Download gff for
BS33366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 15699016..15699153 | 17..154 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-24 09:49:34 Download gff for
BS33366.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 11586521..11586658 | 17..154 | 100 | | Minus |
BS33366.pep Sequence
Translation from 16 to 153
> BS33366.pep
MEHIRFVDKVFRALIAGTLLLLMTAIYREDNNSGSHYIHPRHAMQ*
BS33366.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:56:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42662-PC | 45 | CG42662-PC | 1..45 | 1..45 | 234 | 100 | Plus |
CG42662-PD | 45 | CG42662-PD | 1..45 | 1..45 | 234 | 100 | Plus |
CG42662-PB | 45 | CG42662-PB | 1..45 | 1..45 | 234 | 100 | Plus |
CG42662-PA | 45 | CG42662-PA | 1..45 | 1..45 | 234 | 100 | Plus |