Clone BS33366 Report

Search the DGRC for BS33366

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:333
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG42662-RA
Protein status:BS33366.pep: full length peptide match
Sequenced Size:170

Clone Sequence Records

BS33366.complete Sequence

170 bp assembled on 2014-01-24

GenBank Submission: KX805995

> BS33366.complete
GAAGTTATCAGTCGACATGGAGCACATTCGATTTGTTGACAAAGTCTTTA
GAGCCCTGATCGCCGGCACCCTGCTGCTCCTGATGACCGCCATTTACCGG
GAGGACAACAACTCCGGATCCCACTACATCCATCCAAGACACGCCATGCA
GTAGAAGCTTTCTAGACCAT

BS33366.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 138 CG42662-PC 1..138 17..154 690 100 Plus
CG42662-RD 138 CG42662-PD 1..138 17..154 690 100 Plus
CG42662-RB 138 CG42662-PB 1..138 17..154 690 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 1695 CG42662-RC 1266..1405 15..154 700 100 Plus
CG42662-RD 500 CG42662-RD 71..210 15..154 700 100 Plus
CG42662-RB 2791 CG42662-RB 2362..2501 15..154 700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15699016..15699155 154..15 700 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:55:30 has no hits.

BS33366.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-24 09:49:34 Download gff for BS33366.complete
Subject Subject Range Query Range Percent Splice Strand
CG42662-RC 1268..1405 17..154 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:26:50 Download gff for BS33366.complete
Subject Subject Range Query Range Percent Splice Strand
CG42662-RB 2364..2501 17..154 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:26:50 Download gff for BS33366.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15699016..15699153 17..154 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-24 09:49:34 Download gff for BS33366.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11586521..11586658 17..154 100   Minus

BS33366.pep Sequence

Translation from 16 to 153

> BS33366.pep
MEHIRFVDKVFRALIAGTLLLLMTAIYREDNNSGSHYIHPRHAMQ*

BS33366.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-PC 45 CG42662-PC 1..45 1..45 234 100 Plus
CG42662-PD 45 CG42662-PD 1..45 1..45 234 100 Plus
CG42662-PB 45 CG42662-PB 1..45 1..45 234 100 Plus
CG42662-PA 45 CG42662-PA 1..45 1..45 234 100 Plus