Clone BS33586 Report

Search the DGRC for BS33586

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:335
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG18223-RC
Protein status:BS33586.pep: full length peptide match
Sequenced Size:329

Clone Sequence Records

BS33586.complete Sequence

329 bp assembled on 2015-03-10

GenBank Submission: KX801445

> BS33586.complete
GAAGTTATCAGTCGACATGTTGCTACTGAAATATGGAGTATCTAGGAAAA
TCTTCAGTTTCCTACTGTTCCTCTTGTTGCTTCTGCCGATCCTTGACGCC
GGTGATCCGATTGGCAGCCACTTCGTCCGCCGGCGGGCTAAACGCCTTTC
CAGTCCCTATTTCGACAAGGAAAAAACGTTGGTTCTGGCCAAATATGTAG
TCTCGATTCGATCCCGAAGACCCCACAAGTTATTTGGCGACAATCACTTC
TGCGGTGGCGTGATCATATCGAGAACCTACATCCTCACCTCCGCCCACTG
CGCCATGGAGTAGAAGCTTTCTAGACCAT

BS33586.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18223-RC 297 CG18223-PC 1..297 17..313 1485 100 Plus
CG18223-RA 969 CG18223-PA 1..293 17..309 1465 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18223-RC 990 CG18223-RC 20..316 17..313 1485 100 Plus
CG18223-RA 988 CG18223-RA 20..312 17..309 1465 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18920004..18920300 313..17 1485 100 Minus
Blast to na_te.dros performed 2015-03-10 14:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 2102..2171 123..58 124 68.6 Minus

BS33586.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:11:41 Download gff for BS33586.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RC 25..316 22..313 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:11:41 Download gff for BS33586.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18920004..18920295 22..313 100   Minus

BS33586.pep Sequence

Translation from 16 to 312

> BS33586.pep
MLLLKYGVSRKIFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFD
KEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAME*

BS33586.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG18223-PC 98 CG18223-PC 1..98 1..98 501 100 Plus
CG18223-PA 322 CG18223-PA 1..98 1..98 498 99 Plus
CG13527-PA 290 CG13527-PA 7..80 15..97 205 50.6 Plus
CG13527-PB 292 CG13527-PB 7..80 15..97 205 50.6 Plus
CG4477-PB 315 CG4477-PB 7..88 15..95 169 44.6 Plus