BS33586.complete Sequence
329 bp assembled on 2015-03-10
GenBank Submission: KX801445
> BS33586.complete
GAAGTTATCAGTCGACATGTTGCTACTGAAATATGGAGTATCTAGGAAAA
TCTTCAGTTTCCTACTGTTCCTCTTGTTGCTTCTGCCGATCCTTGACGCC
GGTGATCCGATTGGCAGCCACTTCGTCCGCCGGCGGGCTAAACGCCTTTC
CAGTCCCTATTTCGACAAGGAAAAAACGTTGGTTCTGGCCAAATATGTAG
TCTCGATTCGATCCCGAAGACCCCACAAGTTATTTGGCGACAATCACTTC
TGCGGTGGCGTGATCATATCGAGAACCTACATCCTCACCTCCGCCCACTG
CGCCATGGAGTAGAAGCTTTCTAGACCAT
BS33586.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:08:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18223-RC | 297 | CG18223-PC | 1..297 | 17..313 | 1485 | 100 | Plus |
CG18223-RA | 969 | CG18223-PA | 1..293 | 17..309 | 1465 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:08:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18223-RC | 990 | CG18223-RC | 20..316 | 17..313 | 1485 | 100 | Plus |
CG18223-RA | 988 | CG18223-RA | 20..312 | 17..309 | 1465 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:08:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 18920004..18920300 | 313..17 | 1485 | 100 | Minus |
Blast to na_te.dros performed 2015-03-10 14:08:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 2102..2171 | 123..58 | 124 | 68.6 | Minus |
BS33586.complete Sim4 Records
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:11:41 Download gff for
BS33586.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18223-RC | 25..316 | 22..313 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:11:41 Download gff for
BS33586.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18920004..18920295 | 22..313 | 100 | | Minus |
BS33586.pep Sequence
Translation from 16 to 312
> BS33586.pep
MLLLKYGVSRKIFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFD
KEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAME*
BS33586.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:07:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18223-PC | 98 | CG18223-PC | 1..98 | 1..98 | 501 | 100 | Plus |
CG18223-PA | 322 | CG18223-PA | 1..98 | 1..98 | 498 | 99 | Plus |
CG13527-PA | 290 | CG13527-PA | 7..80 | 15..97 | 205 | 50.6 | Plus |
CG13527-PB | 292 | CG13527-PB | 7..80 | 15..97 | 205 | 50.6 | Plus |
CG4477-PB | 315 | CG4477-PB | 7..88 | 15..95 | 169 | 44.6 | Plus |