Clone BS33587 Report

Search the DGRC for BS33587

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:335
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG33293-RA
Protein status:BS33587.pep: full length peptide match
Sequenced Size:293

Clone Sequence Records

BS33587.complete Sequence

293 bp assembled on 2015-03-10

GenBank Submission: KX803143

> BS33587.complete
GAAGTTATCAGTCGACATGGAACGATTCGCACTGACAACCTGCATTCGCC
GTGTCTGGATCATGTCCGGATGGCTGCGCCAGGAGGCGGCAATAGCAGCC
GGCATGTTGGTGGTGCAGCGACACCAGGTTGAGCTGAGGAATGAGGAGGA
GGAGGGGCTCAAAGTCGGACAGCAGACTGCATCCAGTGGCGGTGACGTGG
GCGTGGACTCGCAAGGAAGACTCCGCCGCGTGCGGCTGCTAGACGACTAC
ATTGTGCCCTTTGAATGCGGTCTTTGAAAGCTTTCTAGACCAT

BS33587.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 261 CG33293-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..371 17..277 1305 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240304..5240564 277..17 1305 100 Minus
Blast to na_te.dros performed on 2015-03-10 14:08:47 has no hits.

BS33587.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:11:42 Download gff for BS33587.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 111..370 17..276 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:11:42 Download gff for BS33587.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5240305..5240564 17..276 100   Minus

BS33587.pep Sequence

Translation from 16 to 276

> BS33587.pep
MERFALTTCIRRVWIMSGWLRQEAAIAAGMLVVQRHQVELRNEEEEGLKV
GQQTASSGGDVGVDSQGRLRRVRLLDDYIVPFECGL*

BS33587.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 86 CG33293-PA 1..86 1..86 441 100 Plus