Clone BS33663 Report

Search the DGRC for BS33663

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:336
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptBG642312-RA
Protein status:BS33663.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS33663.complete Sequence

266 bp assembled on 2015-03-10

GenBank Submission: KX805501

> BS33663.complete
GAAGTTATCAGTCGACATGCCCATCAATCGAATCAATCCCAGCACAGCCA
TGAGAAGCGCGTCGCTTAAGTTCTATCTGATATGTCTGCTAGTTATCTGC
GTGATCGGTTGGAGTGCTGGAGCACCGAGTCCGCAACTTTCACGTAAGGA
ACTCGAGGATCGATATCGACAAAAGCCCCCGGTGCCTGATGAGCGAGATG
CGGATGCAGAATTGGATAGTGCCTACGATCGGAATACCCGAAGACCTTGA
AAGCTTTCTAGACCAT

BS33663.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2015-03-10 14:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-RB 234 CG33943-PB 1..234 17..250 1170 100 Plus
BG642312-RA 234 CG33943-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-RB 503 CG33943-RB 115..349 17..251 1175 100 Plus
BG642312-RA 540 CG33943-RA 152..386 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-03-10 14:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6232623..6232773 251..101 755 100 Minus
3L 28110227 3L 6232837..6232921 101..17 425 100 Minus
Blast to na_te.dros performed on 2015-03-10 14:09:24 has no hits.

BS33663.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-03-10 14:12:03 Download gff for BS33663.complete
Subject Subject Range Query Range Percent Splice Strand
BG642312-RB 115..347 17..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-03-10 14:12:03 Download gff for BS33663.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6232625..6232772 102..249 100 <- Minus
3L 6232837..6232921 17..101 100   Minus

BS33663.pep Sequence

Translation from 16 to 249

> BS33663.pep
MPINRINPSTAMRSASLKFYLICLLVICVIGWSAGAPSPQLSRKELEDRY
RQKPPVPDERDADAELDSAYDRNTRRP*

BS33663.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2015-03-10 14:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-PB 77 CG33943-PB 1..77 1..77 404 100 Plus
BG642312-PA 77 CG33943-PA 1..77 1..77 404 100 Plus