Clone FI01003 Report

Search the DGRC for FI01003

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:3
Vector:pFlc-1
Associated Gene/TranscriptTfb4-RA
Protein status:FI01003.pep: gold
Sequenced Size:1011

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Tfb4 2008-04-29 Release 5.5 accounting
Tfb4 2008-08-15 Release 5.9 accounting
Tfb4 2008-12-18 5.12 accounting

Clone Sequence Records

FI01003.complete Sequence

1011 bp (1011 high quality bases) assembled on 2006-09-12

GenBank Submission: BT025234

> FI01003.complete
CTGTAGCGATAACATTGCCGGCGAAAATGGAAGCAGATCAAGCAGCAAGC
AAGGAAGCCGAATCATGCATCGACCTCTTGGTGATCGTCCTGGACACGAA
CCCCTCCCAGCACTTCGTGCGCCAGAACCCACAGAACCTCACGCAAATCC
TGGAGGCGGTGATTGCCTTTGGGAATGCTCACCTGATGCAGAAGGCCCAG
AACAAACTGGCTGTGGTATCCTGCTCCCACCATGCCACAAACTTCCTGTA
TCCGCTGCCCAGAAGACAAGTGGAACTGCGCCAAGTGGATGGGCAGTACG
AGGCGTTTAATCTGGTGGAGAAGACGGTGAAGCAGCAGCTGGGCAGCATC
CTGATGAACGCACCACGGCTCAGCGCTCCTTGTGAGAGTCTCCTGGCCGG
CAGCATGTCCATGGCGCTGTGCTACATATCAAGGCTCCAGAGGAATCTGG
CTCCTGGCGTCAAGATGCATTCCCGCATCCTGGTCGTCACAGGCAGCAAC
GAGTGCGCCTCGCAGTACATGACGTTCATGAACGTCTTCTTCACCGCCCA
GAAACTGGGCATCACGATCGATACCTGCGCCCTGGACAAGACCCTCAGTT
TGCTACAGCAAGGCTGTGACATTACCTCCGGACAGTTCCTCAAGGTCACC
CAGCTGGACGGCCTGCTGCAGTACCTCCTGTGGGTCTTCCTGCCCGCCCC
GCAGATCCGTCACAAATTGGTCCTGCCGCCACCGCCCAAAGTGGACTACC
GCGCCTCCTGCTTCTGCCATCGTGAGCTGATCGACATTGGCTACGTCTGC
TCGGTTTGCCTCTCGGTCTTCTGCAAATACAGTCCCATATGCACCACTTG
CCACACCATTTTCAAGAATCCCGGTCCTCTGCCCATCAAGGGCAAAAAGA
AAAAGAAGACCGACAAGCAAATGTAATTCCAGCAGTAGAAAATACTGGTT
ACCAAAGGAAGCAGTATGTTAAATATAAAGGTACCTTTTTAGTTTAAAAA
AAAAAAAAAAA

FI01003.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Tfb4-RA 1031 Tfb4-RA 40..1031 4..995 4960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1149568..1149987 853..434 2085 99.8 Minus
chr2L 23010047 chr2L 1150048..1150243 434..239 950 99 Minus
chr2L 23010047 chr2L 1150296..1150478 238..56 870 98.4 Minus
chr2L 23010047 chr2L 1149362..1149503 995..854 710 100 Minus
chr2L 23010047 chr2L 1150534..1150587 57..4 240 96.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1149651..1150070 853..434 2100 100 Minus
2L 23513712 2L 1150131..1150326 434..239 980 100 Minus
2L 23513712 2L 1150379..1150561 238..56 915 100 Minus
2L 23513712 2L 1149444..1149586 996..854 715 100 Minus
2L 23513712 2L 1150617..1150670 57..4 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1149651..1150070 853..434 2100 100 Minus
2L 23513712 2L 1150131..1150326 434..239 980 100 Minus
2L 23513712 2L 1150379..1150561 238..56 915 100 Minus
2L 23513712 2L 1149444..1149586 996..854 715 100 Minus
2L 23513712 2L 1150617..1150670 57..4 270 100 Minus
Blast to na_te.dros performed 2019-03-16 15:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 4887..4984 885..974 120 63.3 Plus

FI01003.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:01:46 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1149362..1149503 854..995 100 <- Minus
chr2L 1149568..1149986 435..853 99 <- Minus
chr2L 1150048..1150243 239..434 98 <- Minus
chr2L 1150296..1150476 58..238 98 <- Minus
chr2L 1150534..1150590 1..57 94   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:33:27 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..900 27..926 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:21:13 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..900 27..926 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:39 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..900 27..926 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:25 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..900 27..926 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:01 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..900 27..926 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:43 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..995 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:21:13 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..995 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:39 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 5..999 1..995 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:25 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 1..995 1..995 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:01 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
Tfb4-RA 5..999 1..995 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:46 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1149445..1149586 854..995 100 <- Minus
2L 1149651..1150069 435..853 100 <- Minus
2L 1150131..1150326 239..434 100 <- Minus
2L 1150379..1150559 58..238 100 <- Minus
2L 1150617..1150673 1..57 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:46 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1149445..1149586 854..995 100 <- Minus
2L 1149651..1150069 435..853 100 <- Minus
2L 1150131..1150326 239..434 100 <- Minus
2L 1150379..1150559 58..238 100 <- Minus
2L 1150617..1150673 1..57 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:46 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1149445..1149586 854..995 100 <- Minus
2L 1149651..1150069 435..853 100 <- Minus
2L 1150131..1150326 239..434 100 <- Minus
2L 1150379..1150559 58..238 100 <- Minus
2L 1150617..1150673 1..57 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:39 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1149445..1149586 854..995 100 <- Minus
arm_2L 1149651..1150069 435..853 100 <- Minus
arm_2L 1150131..1150326 239..434 100 <- Minus
arm_2L 1150379..1150559 58..238 100 <- Minus
arm_2L 1150617..1150673 1..57 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:09:26 Download gff for FI01003.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1149651..1150069 435..853 100 <- Minus
2L 1150131..1150326 239..434 100 <- Minus
2L 1150379..1150559 58..238 100 <- Minus
2L 1150617..1150673 1..57 98   Minus
2L 1149445..1149586 854..995 100 <- Minus

FI01003.hyp Sequence

Translation from 2 to 925

> FI01003.hyp
LAITLPAKMEADQAASKEAESCIDLLVIVLDTNPSQHFVRQNPQNLTQIL
EAVIAFGNAHLMQKAQNKLAVVSCSHHATNFLYPLPRRQVELRQVDGQYE
AFNLVEKTVKQQLGSILMNAPRLSAPCESLLAGSMSMALCYISRLQRNLA
PGVKMHSRILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCALDKTLSL
LQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYR
ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIFKNPGPLPIKGKKK
KKTDKQM*

FI01003.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Tfb4-PA 299 CG5041-PA 1..299 9..307 1564 100 Plus

FI01003.pep Sequence

Translation from 26 to 925

> FI01003.pep
MEADQAASKEAESCIDLLVIVLDTNPSQHFVRQNPQNLTQILEAVIAFGN
AHLMQKAQNKLAVVSCSHHATNFLYPLPRRQVELRQVDGQYEAFNLVEKT
VKQQLGSILMNAPRLSAPCESLLAGSMSMALCYISRLQRNLAPGVKMHSR
ILVVTGSNECASQYMTFMNVFFTAQKLGITIDTCALDKTLSLLQQGCDIT
SGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCHRE
LIDIGYVCSVCLSVFCKYSPICTTCHTIFKNPGPLPIKGKKKKKTDKQM*

FI01003.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14734-PA 297 GF14734-PA 1..286 1..287 1436 93.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24611-PA 299 GG24611-PA 1..299 1..299 1573 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10566-PA 300 GH10566-PA 4..282 3..281 1379 90.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Tfb4-PA 299 CG5041-PA 1..299 1..299 1564 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21952-PA 299 GI21952-PA 1..286 1..285 1363 88.8 Plus
Dmoj\GI10128-PA 334 GI10128-PA 27..306 16..285 494 36.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15043-PA 298 GL15043-PA 1..287 1..287 1426 91.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18615-PA 298 GA18615-PA 1..287 1..287 1440 92 Plus
Dpse\GA22626-PA 390 GA22626-PA 26..311 1..275 262 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16625-PA 299 GM16625-PA 1..299 1..299 1586 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22925-PA 299 GD22925-PA 1..299 1..299 1590 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17829-PA 300 GJ17829-PA 1..281 1..280 1372 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24367-PA 303 GK24367-PA 14..292 8..286 1337 86.7 Plus
Dwil\GK25630-PA 310 GK25630-PA 46..307 16..263 418 34.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15755-PA 299 GE15755-PA 1..299 1..299 1585 98.7 Plus