Clone FI01006 Report

Search the DGRC for FI01006

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:6
Vector:pFlc-1
Associated Gene/TranscriptBin1-RA
Protein status:FI01006.pep: gold
Sequenced Size:679

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Bin1 2008-04-29 Release 5.5 accounting
Bin1 2008-08-15 Release 5.9 accounting
Bin1 2008-12-18 5.12 accounting

Clone Sequence Records

FI01006.complete Sequence

679 bp (679 high quality bases) assembled on 2006-09-22

GenBank Submission: BT025229

> FI01006.complete
ATTCGATTATATAGTTATCGAAAAGAGCAAAGAGAAGCCGGAATATACGG
CATTAAAAGTGCATTTTGTATTAAAATTAAGAAAATTAGTAACGATATAC
CGCAGAATAGGGAGACATGGCCAACGTGGAATCTATGATTGTGGAGGAAA
AGACGCAGGTCAAGCAGATTGACCGCGAGAAGACCTGTCCTATGCTGCTC
CGTGTCTTCTGCTCTACGGGACGACACCACTCCGTGTCGGAGTATATGTT
CGGCAACGTGCCCACCAACGAGCTTCAGATTTACACCTGGCAAGACGCCA
CCCTGCACGAACTGACCTCTCTGGTGCGAGACGTCAATCCGGACACCCGG
AAGAAGGGCACCTACTTTGACTTTGCTGTCGTGTACCCCAACTTCCGGAG
TAATCACTTCCAGATGCGCGAAATCGGAGTGACCTGCACGGGTCAAAAAG
GAATCGATGATAATAAGACACTTGCTCAGGCCAAATTCAGCATTGGAGAC
TTTCTGGACATCTCGATTACTCCGCCCAACCGACTGCCGCCAACCGCCAG
GCGCCAGCGTCCGTACTGATTCTTCACTTTCATCTATTCTAATCATTTTA
ATCTTTCACTTGACACTCAATGGAGTATGAACATAATTATAAGTGGAATA
CAAGTAAAAAAAATAAAAAAAAAAAAAAA

FI01006.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Bin1-RA 823 Bin1-RA 76..732 1..657 3285 100 Plus
Bin1.a 645 Bin1.a 159..635 181..657 2385 100 Plus
Bin1.a 645 Bin1.a 3..160 1..158 790 100 Plus
CG8927-RA 1342 CG8927-RA 1270..1342 657..585 365 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12010749..12011225 657..181 2370 99.8 Minus
chr3R 27901430 chr3R 12011297..12011478 182..1 910 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16186164..16186640 657..181 2385 100 Minus
3R 32079331 3R 16186712..16186893 182..1 910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15926995..15927471 657..181 2385 100 Minus
3R 31820162 3R 15927543..15927724 182..1 910 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:54:07 has no hits.

FI01006.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:55:00 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12010741..12011223 183..664 98 <- Minus
chr3R 12011297..12011478 1..182 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:33:40 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..453 117..569 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:25:52 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..453 117..569 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:22 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..453 117..569 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:45:48 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..453 117..569 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:44:13 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..453 117..569 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:54:26 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..663 1..663 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:25:52 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..663 1..663 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:22 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..663 1..663 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:45:48 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 1..663 1..663 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:44:13 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
Bin1-RA 5..667 1..664 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:00 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16186156..16186638 183..664 99 <- Minus
3R 16186712..16186893 1..182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:00 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16186156..16186638 183..664 99 <- Minus
3R 16186712..16186893 1..182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:00 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16186156..16186638 183..664 99 <- Minus
3R 16186712..16186893 1..182 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:22 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12011878..12012360 183..664 99 <- Minus
arm_3R 12012434..12012615 1..182 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:52:54 Download gff for FI01006.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15926987..15927469 183..664 99 <- Minus
3R 15927543..15927724 1..182 100   Minus

FI01006.pep Sequence

Translation from 116 to 568

> FI01006.pep
MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPT
NELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQM
REIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY
*

FI01006.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18851-PA 150 GF18851-PA 1..150 1..150 784 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20135-PA 150 GG20135-PA 1..150 1..150 809 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18835-PA 149 GH18835-PA 1..149 1..150 770 94 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Bin1-PC 150 CG6046-PC 1..150 1..150 798 100 Plus
Bin1-PB 150 CG6046-PB 1..150 1..150 798 100 Plus
Bin1-PA 150 CG6046-PA 1..150 1..150 798 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10094-PA 149 GI10094-PA 1..149 1..150 777 94.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12401-PA 150 GL12401-PA 1..150 1..150 799 97.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19319-PA 150 GA19319-PA 1..150 1..150 791 96.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25728-PA 150 GM25728-PA 1..150 1..150 815 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20305-PA 150 GD20305-PA 1..150 1..150 812 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23830-PA 149 GJ23830-PA 1..149 1..150 776 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14011-PA 150 GK14011-PA 1..150 1..150 785 94.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26332-PA 150 GE26332-PA 1..150 1..150 809 98.7 Plus

FI01006.hyp Sequence

Translation from 116 to 568

> FI01006.hyp
MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPT
NELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQM
REIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY
*

FI01006.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Bin1-PC 150 CG6046-PC 1..150 1..150 798 100 Plus
Bin1-PB 150 CG6046-PB 1..150 1..150 798 100 Plus
Bin1-PA 150 CG6046-PA 1..150 1..150 798 100 Plus