Clone FI01012 Report

Search the DGRC for FI01012

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:12
Vector:pFlc-1
Associated Gene/TranscriptTfIIA-S-RA
Protein status:FI01012.pep: gold
Sequenced Size:608

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
TfIIA-S 2008-08-15 Release 5.9 accounting
TfIIA-S 2008-12-18 5.12 accounting

Clone Sequence Records

FI01012.complete Sequence

608 bp assembled on 2008-07-21

GenBank Submission: BT044069.1

> FI01012.complete
AAAAATTTTTGCTTGACTTGACAGGTTCGTAGAAAAGTCGCAGAAGAAAA
AGCTGTTCCGTCGGAATTAAGGCAGCCACTATGTCGTATCAACTGTACCG
CAACACCACGCTCGGCAACACCCTGCAGGAGAGCCTCGACGAGCTGATTC
AGTACGGCCAGATTACGCCCGGACTGGCTTTCAAGGTTCTGCTGCAATTC
GACAAGAGCATCAACAATGCCCTAAACCAGCGGGTCAAGGCCCGCGTCAC
CTTCAAGGCTGGAAAACTAAACACCTACCGCTTCTGCGACAATGTCTGGA
CTCTCATGCTTAACGATGTGGAGTTCCGCGAAGTGCACGAGATCGTCAAG
GTGGACAAGGTGAAGATCGTGGCCTGCGACGGCAAGAGCGGCGAGTTCTG
AACACCACCGACCCGATCTGAACACCCAATGTAACCCCACTAAACACACC
ATGTAACCCCACAAAACACACCATTATAACCATTACAAATAGCTGTAAGA
TTCGTAGGCGATAAGCTGGGTTGGAAAACGAAAACCGACCGTGCGATGCA
GCAGGCATTGCAAGAAATACACTGTTAATTCACAGTTCACTGAAAAAAAA
AAAAAAAA

FI01012.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-RA 834 TfIIA-S-RA 145..734 1..590 2950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19713810..19714250 590..150 2190 99.8 Minus
chr3R 27901430 chr3R 19714304..19714455 152..1 745 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23890390..23890830 590..150 2205 100 Minus
3R 32079331 3R 23890884..23891035 152..1 760 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23631221..23631661 590..150 2205 100 Minus
3R 31820162 3R 23631715..23631866 152..1 760 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:34:01 has no hits.

FI01012.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:35:01 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19713808..19714247 153..592 99 <- Minus
chr3R 19714304..19714455 1..152 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:34:05 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 1..321 81..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:22 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 1..321 81..401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:53 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 1..321 81..401 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:16 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 1..321 81..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:00 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 1..321 81..401 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:26:41 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 22..613 1..592 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:22 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 22..613 1..592 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:53 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 26..617 1..592 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:45:17 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 22..613 1..592 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:00 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 26..617 1..592 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:01 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23890388..23890827 153..592 99 <- Minus
3R 23890884..23891035 1..152 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:01 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23890388..23890827 153..592 99 <- Minus
3R 23890884..23891035 1..152 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:01 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23890388..23890827 153..592 99 <- Minus
3R 23890884..23891035 1..152 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:53 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19716110..19716549 153..592 99 <- Minus
arm_3R 19716606..19716757 1..152 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:45 Download gff for FI01012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23631219..23631658 153..592 99 <- Minus
3R 23631715..23631866 1..152 100   Minus

FI01012.hyp Sequence

Translation from 80 to 400

> FI01012.hyp
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQ
RVKARVTFKAGKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACD
GKSGEF*

FI01012.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-PA 106 CG5163-PA 1..106 1..106 547 100 Plus
TfIIA-S-2-PA 107 CG11639-PA 1..101 1..101 278 55.4 Plus

FI01012.pep Sequence

Translation from 80 to 400

> FI01012.pep
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQ
RVKARVTFKAGKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACD
GKSGEF*

FI01012.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18732-PA 106 GF18732-PA 1..106 1..106 550 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12397-PA 106 GG12397-PA 1..106 1..106 556 99.1 Plus
Dere\GG12724-PA 104 GG12724-PA 1..102 1..102 334 58.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10565-PA 107 GH10565-PA 1..106 1..106 545 97.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-PA 106 CG5163-PA 1..106 1..106 547 100 Plus
TfIIA-S-2-PA 107 CG11639-PA 1..101 1..101 278 55.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23054-PA 107 GI23054-PA 1..106 1..106 538 96.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24263-PA 105 GL24263-PA 1..103 1..103 539 99 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18701-PA 105 GA18701-PA 1..103 1..103 539 99 Plus
Dpse\GA26545-PA 129 GA26545-PA 1..108 1..105 314 58.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23533-PA 106 GM23533-PA 1..106 1..106 556 99.1 Plus
Dsec\GM19003-PA 107 GM19003-PA 1..102 1..102 303 55.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18345-PA 106 GD18345-PA 1..106 1..106 556 99.1 Plus
Dsim\GD24638-PA 107 GD24638-PA 1..102 1..102 307 56.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24638-PA 107 GJ24638-PA 1..106 1..106 547 97.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11978-PA 106 GK11978-PA 1..106 1..106 551 98.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23914-PA 106 GE23914-PA 1..106 1..106 556 99.1 Plus
Dyak\GE16551-PA 104 GE16551-PA 1..103 1..103 345 61.2 Plus