Clone FI01030 Report

Search the DGRC for FI01030

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:30
Vector:pFlc-1
Associated Gene/TranscriptMat1-RA
Protein status:FI01030.pep: gold
Sequenced Size:1236

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Mat1 2008-04-29 Release 5.5 accounting
Mat1 2008-08-15 Release 5.9 accounting
Mat1 2008-12-18 5.12 accounting

Clone Sequence Records

FI01030.complete Sequence

1236 bp (1236 high quality bases) assembled on 2006-09-12

GenBank Submission: BT025213

> FI01030.complete
GATGGTCACATTAGGGAATGCATCAAATAATAATTTATCGAAAACATTGG
CCGGCAAAGAGTTTTTATTTACGGATTTAAGCAGCAGAGAGGAGGACAGG
TAAACCGGCTACGCGATGGACGACCAGGCGTGCCCGCGGTGCAAGACCAC
CAAATACCGGAATCCATCGCTCAAGCTGATGGTCAACGTTTGCGGACACA
CATTATGCGAATCTTGCGTGGACTTGCTGTTCCTCAAAGGATCCGGCGCC
TGTCCAGAGTGCATGGTCCCATTGCGGCGCAACAACTTCCGCGTGCAGCT
TTTTGAGGACCCAATGGTGGAGAAGGAGGTGGATATTCGTAGGCGAATTC
TGCGCGACTACAATAAACGTGAGGAGGACTTTGCCTCCCTGGCGGAGTAC
AATGACTATCTGGAGGAGATCGAGGACATTGTGTACAATCTGTGCAACAA
CATCGACATCATCGAGACAAACAAGCGTATTGAGGCCTACAAGCGTGATA
ACCGTGAGGTCATTCAGCGGAATAAAACCCGCGTGGGACGCGATGAGTAC
GCGTTGGAGGAGATGCTGGAGCTGGAGAAAGTTCAGGAGGAGGCGCGTAG
GAAGGAGCTGGAGGAACTGGAGAACGAGCACAAGAAGAAGAAGGCCCGCG
ACAAGCAGGCGCTGATCGAGGAGCTGATGTACAGCGGCAAGGATGCCGCC
CAAATTGTCACCGAGTTCGCCGAAAAAGCGGAAAAGCAGCGCGAGGAGGA
GAAACAGCTTCCACCGCCGAAGCCCGCCAACGAGTTCTCTACGGGCATAA
AGTTCGGACAGACAGCTGATCCCAGTCTGCTGCCCGTTCCCAAATCGGAG
GAGGGTCCACTTTTCGTATACGAGCCACTTGTTCCTTTCAGTGAGGGACC
TGCCATGCCGCCCACAAATGAGATCGTGTCCAGGGGCTATATTGCCCACA
TACGAGCTGAAACACCGCAGGAGAACGCCGGCGGATTCACATCCGCTCTG
GCTTGTGAACGGGCGCTTCAGGAGGCGCTGCAGGGACTCTACTATACGGC
TACAACGGGTGTGGTATCTGGCACCTAGCTCTCTAAAAAAATATCCTTTA
ATGGTCGCACAACCAGAGCACTGAACGCTTAATTTTGTTGAACAAATGTG
TCCTATACGAATCCATTCAGTTAACTCGTAACTTAATATATGTTAAATAA
ATAAATGCTATATCCTAAAGAAAAAAAAAAAAAAAA

FI01030.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Mat1-RA 1218 Mat1-RA 1..1216 2..1217 6080 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6626186..6627401 1217..2 6080 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10738619..10739834 1217..2 6080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10739818..10741033 1217..2 6080 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:07:16 has no hits.

FI01030.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:08:20 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6626184..6627401 1..1220 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:34:56 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..963 116..1078 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:20:39 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..963 116..1078 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:09:13 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..963 116..1078 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:51:16 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..963 116..1078 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:12:32 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..963 116..1078 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:58:51 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..1218 2..1220 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:20:39 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..1218 2..1220 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:09:13 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..1213 7..1220 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:51:16 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..1218 2..1220 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:12:32 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
Mat1-RA 1..1213 7..1220 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:20 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10738617..10739834 1..1220 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:20 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10738617..10739834 1..1220 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:20 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10738617..10739834 1..1220 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:09:13 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6626122..6627339 1..1220 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:09:02 Download gff for FI01030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10739816..10741033 1..1220 99   Minus

FI01030.pep Sequence

Translation from 115 to 1077

> FI01030.pep
MDDQACPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFLKGSGACPECM
VPLRRNNFRVQLFEDPMVEKEVDIRRRILRDYNKREEDFASLAEYNDYLE
EIEDIVYNLCNNIDIIETNKRIEAYKRDNREVIQRNKTRVGRDEYALEEM
LELEKVQEEARRKELEELENEHKKKKARDKQALIEELMYSGKDAAQIVTE
FAEKAEKQREEEKQLPPPKPANEFSTGIKFGQTADPSLLPVPKSEEGPLF
VYEPLVPFSEGPAMPPTNEIVSRGYIAHIRAETPQENAGGFTSALACERA
LQEALQGLYYTATTGVVSGT*

FI01030.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11091-PA 320 GF11091-PA 1..320 1..320 1487 90 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22722-PA 320 GG22722-PA 1..320 1..320 1656 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20616-PA 320 GH20616-PA 1..316 1..316 1445 87.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Mat1-PA 320 CG7614-PA 1..320 1..320 1666 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19171-PA 320 GI19171-PA 1..319 1..319 1424 87.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17185-PA 320 GL17185-PA 1..319 1..319 1526 89.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20481-PA 320 GA20481-PA 1..319 1..319 1524 89.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20498-PA 276 GM20498-PA 1..276 1..320 1389 84.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25961-PA 334 GD25961-PA 38..334 24..320 1541 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20128-PA 320 GJ20128-PA 1..319 1..319 1426 88.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19660-PA 321 GK19660-PA 1..314 1..314 1479 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13079-PA 320 GE13079-PA 1..320 1..320 1648 97.5 Plus

FI01030.hyp Sequence

Translation from 115 to 1077

> FI01030.hyp
MDDQACPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFLKGSGACPECM
VPLRRNNFRVQLFEDPMVEKEVDIRRRILRDYNKREEDFASLAEYNDYLE
EIEDIVYNLCNNIDIIETNKRIEAYKRDNREVIQRNKTRVGRDEYALEEM
LELEKVQEEARRKELEELENEHKKKKARDKQALIEELMYSGKDAAQIVTE
FAEKAEKQREEEKQLPPPKPANEFSTGIKFGQTADPSLLPVPKSEEGPLF
VYEPLVPFSEGPAMPPTNEIVSRGYIAHIRAETPQENAGGFTSALACERA
LQEALQGLYYTATTGVVSGT*

FI01030.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Mat1-PA 320 CG7614-PA 1..320 1..320 1666 100 Plus