Clone FI01032 Report

Search the DGRC for FI01032

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:10
Well:32
Vector:pFlc-1
Associated Gene/TranscriptMax-RA
Protein status:FI01032.pep: gold
Sequenced Size:852

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Max 2008-04-29 Release 5.5 accounting
Max 2008-08-15 Release 5.9 accounting
Max 2008-12-18 5.12 accounting

Clone Sequence Records

FI01032.complete Sequence

852 bp (852 high quality bases) assembled on 2006-09-12

GenBank Submission: BT025211

> FI01032.complete
GCCTCTATTTGGTCACTCTGCAAGTCTTACAACGTGAGCAGACAACAACA
AAATTACATGTTTATTTGGAATAATCACAAAAAACAAAAAACTTACCAAC
TTAGTGGAATAATCTTAGGAAATATCTATTAATTTGCGCGCAATCCGTGC
AAAACAAGTGAAGCAACATGAGTATGAGCGACGACGACCGCGACATAGAC
ATCGAAAGTGACGAGGACGGGGACTCGGACACTGGCTTGGGATCCTCGCG
ACACACAAACACCGCCAATTTCACCCAGGCCGAAAAGCGGGCGCACCACA
ACGCTTTGGAGCGAAGGCGGCGCGATCACATCAAGGAGAGCTTCACCAAC
CTGCGTGAGGCGGTGCCCACACTCAAGGGCGAAAAGGCGAGTCGAGCTCA
AATCCTGAAAAAGACCACCGAATGCATACAGACGATGAGGCGGAAGATCA
GTGAAAACCAGAAAGACATCGAAGAGATCAAGAGGCAAAACAACATAATA
GCTAAGCAGATACAAGCACTGGAGAGTTCAAATGGGGATCAGTTCAGCGA
ATTTCTCAGCGACGAGGAAGTGGGCAGCGAGGAGGCCGACGACGAAGACC
TCGACCAGGACTTCAGTAGACGCAATAAAAAGATGAAGACCTTCCACGCA
TAGCCGCTGATCCAATCCAAAGTGCTGCTTACAGGCGTGTTCCGGCTTCC
GTTTTCACCGACATTCTGAATTCTTACGTGGATTTAGTTCAACTTTGAGT
TGTGTTATACGAAAGCAATAGCCCTCGAAAAGTTGTGAAGGAAACGGTTC
CAAATTCGAATTAAAGTGAAAATTAAAATTAAAAAGAAAAAAAAAAAAAA
AA

FI01032.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Max-RA 1138 Max-RA 1..830 2..831 4150 100 Plus
CG42374-RA 1632 CG42374-RA 212..328 213..97 585 100 Minus
CG9666-RA 1632 CG9666-RA 212..328 213..97 585 100 Minus
CG42374-RA 1632 CG42374-RA 71..137 279..213 335 100 Minus
CG9666-RA 1632 CG9666-RA 71..137 279..213 335 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19252161..19252481 831..511 1605 100 Minus
chr3L 24539361 chr3L 19253443..19253653 213..2 980 98.6 Minus
chr3L 24539361 chr3L 19252547..19252672 510..385 630 100 Minus
chr3L 24539361 chr3L 19252879..19252989 387..277 555 100 Minus
chr3L 24539361 chr3L 19253302..19253368 279..213 335 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:04:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19262698..19263018 831..511 1605 100 Minus
3L 28110227 3L 19263980..19264191 213..2 1060 100 Minus
3L 28110227 3L 19263084..19263209 510..385 630 100 Minus
3L 28110227 3L 19263416..19263526 387..277 555 100 Minus
3L 28110227 3L 19263839..19263905 279..213 335 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19255798..19256118 831..511 1605 100 Minus
3L 28103327 3L 19257080..19257291 213..2 1060 100 Minus
3L 28103327 3L 19256184..19256309 510..385 630 100 Minus
3L 28103327 3L 19256516..19256626 387..277 555 100 Minus
3L 28103327 3L 19256939..19257005 279..213 335 100 Minus
Blast to na_te.dros performed 2019-03-16 07:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 508..608 422..519 119 60.4 Plus

FI01032.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:55:08 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19252156..19252481 511..836 98 <- Minus
chr3L 19252547..19252670 387..510 100 <- Minus
chr3L 19252880..19252987 279..386 100 <- Minus
chr3L 19253303..19253368 213..278 100 <- Minus
chr3L 19253444..19253653 1..212 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:34:59 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..486 168..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:32 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..486 168..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:25 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..486 168..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:24 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..486 168..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:44:28 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..486 168..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:41 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..832 2..836 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:32 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..832 2..836 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:25 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..825 9..836 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:24 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..832 2..836 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:44:28 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
Max-RA 1..825 9..836 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:08 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19263084..19263207 387..510 100 <- Minus
3L 19263417..19263524 279..386 100 <- Minus
3L 19263840..19263905 213..278 100 <- Minus
3L 19263981..19264191 1..212 99   Minus
3L 19262693..19263018 511..836 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:08 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19263084..19263207 387..510 100 <- Minus
3L 19263417..19263524 279..386 100 <- Minus
3L 19263840..19263905 213..278 100 <- Minus
3L 19263981..19264191 1..212 99   Minus
3L 19262693..19263018 511..836 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:55:08 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19263084..19263207 387..510 100 <- Minus
3L 19263417..19263524 279..386 100 <- Minus
3L 19263840..19263905 213..278 100 <- Minus
3L 19263981..19264191 1..212 99   Minus
3L 19262693..19263018 511..836 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:25 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19255793..19256118 511..836 98 <- Minus
arm_3L 19256184..19256307 387..510 100 <- Minus
arm_3L 19256517..19256624 279..386 100 <- Minus
arm_3L 19256940..19257005 213..278 100 <- Minus
arm_3L 19257081..19257291 1..212 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:23 Download gff for FI01032.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19256517..19256624 279..386 100 <- Minus
3L 19256940..19257005 213..278 100 <- Minus
3L 19257081..19257291 1..212 99   Minus
3L 19255793..19256118 511..836 98 <- Minus
3L 19256184..19256307 387..510 100 <- Minus

FI01032.hyp Sequence

Translation from 167 to 652

> FI01032.hyp
MSMSDDDRDIDIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERR
RRDHIKESFTNLREAVPTLKGEKASRAQILKKTTECIQTMRRKISENQKD
IEEIKRQNNIIAKQIQALESSNGDQFSEFLSDEEVGSEEADDEDLDQDFS
RRNKKMKTFHA*

FI01032.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
Max-PD 161 CG9648-PD 1..161 1..161 818 100 Plus
Max-PC 161 CG9648-PC 1..161 1..161 818 100 Plus
Max-PA 161 CG9648-PA 1..161 1..161 818 100 Plus

FI01032.pep Sequence

Translation from 167 to 652

> FI01032.pep
MSMSDDDRDIDIESDEDGDSDTGLGSSRHTNTANFTQAEKRAHHNALERR
RRDHIKESFTNLREAVPTLKGEKASRAQILKKTTECIQTMRRKISENQKD
IEEIKRQNNIIAKQIQALESSNGDQFSEFLSDEEVGSEEADDEDLDQDFS
RRNKKMKTFHA*

FI01032.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10774-PA 163 GF10774-PA 23..163 23..161 622 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13417-PA 161 GG13417-PA 22..161 22..161 642 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14421-PA 162 GH14421-PA 1..162 1..161 623 78.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
Max-PD 161 CG9648-PD 1..161 1..161 818 100 Plus
Max-PC 161 CG9648-PC 1..161 1..161 818 100 Plus
Max-PA 161 CG9648-PA 1..161 1..161 818 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13548-PA 160 GI13548-PA 23..160 23..161 513 74.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20913-PA 163 GL20913-PA 22..163 22..161 565 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21938-PA 163 GA21938-PA 22..163 22..161 565 77.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14884-PA 161 GM14884-PA 1..161 1..161 754 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12293-PA 161 GD12293-PA 1..161 1..161 754 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11907-PA 159 GJ11907-PA 23..159 23..161 526 77.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19684-PA 165 GK19684-PA 1..165 1..161 693 82.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22918-PA 161 GE22918-PA 1..161 1..161 737 93.2 Plus
Dyak\GE22514-PA 161 GE22514-PA 1..161 1..161 737 93.2 Plus