Clone FI01130 Report

Search the DGRC for FI01130

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:11
Well:30
Vector:pOT2
Associated Gene/TranscriptCG12934-RA
Protein status:FI01130.pep: gold
Sequenced Size:857

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12934 2008-04-29 Picked prior to 5.5
CG12934 2008-08-15 Release 5.9 accounting
CG12934 2008-12-18 5.12 accounting

Clone Sequence Records

FI01130.complete Sequence

857 bp assembled on 2008-05-14

GenBank Submission: BT032880

> FI01130.complete
ATCAAGATGAAGGCAGCAATAATTTTGGCACTAATCGGTACAGTTTTGAC
GGCTCCGCCAGTCAGGGTGATGCCGAAACCAGGCAGTGAGCTTGATCAGT
ACGCTCACATATTTGCAAAGGTACGACCACCGGGCCAGAAGCACCAGAAC
ATGGAGATTGAATTCCAGCCACAGCACCACAACTCTCTGCCGAGCAACCA
GGTCAATGCGGAAATCAATCATGTGGAGCCCAAGCAGCCTCAGTACATGG
AACAAAGTTCTTCTCAGGTCGAGTCGAGACCTCCTCACACCGTGGACTTT
GAGATCAAGCCGGTGGAGCAGAAGCCACCCCAGCGATTGGAGTTTGAGGT
GAAGCCGCAGCACGAGCAAAACTCTCCTCAGGGACATTTGGTTTCTTTGG
GCGTCAAGCCCGTGGAGCAGAAGCCACCTCAGCACTTGGAGGTGGAGATT
AAGCAGCAGCAGCAACAACATTCTTCGCAAAATCATCAGGTGGAACTGGA
AATCAAGCAGGTGGAACAGAAGCCTCCACAGCACTTGGAAATTGAGATCA
AGCCTGTTGACCAGAAGCCACCGCACCGTGTGGAGCTTGAAGTCCAACAG
CAGCATCACCAAAACTCTGCCCAGGGACACTTGGTTTCTTTGGGAGCAGT
GGAACAGAAGCAACAACACATCGATCATGAGCTGAAGAATTCCCATAAAA
TCGAGCTAGAATTTGTTTAGGAGAATGAGCTTATGGTATTCCAACTGCAG
AAGCAACATTTCTACCTGAATCTGCACCAATAGAGCAGCGGGCCACAAAA
TGTATCCGTTAAACAAAGTGCATTAAATATGTATAATTACAAAAAAAAAA
AAAAAAA

FI01130.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12934-RA 834 CG12934-RA 1..834 7..840 4170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6536493..6537332 1..840 4185 99.9 Plus
chr2R 21145070 chr2R 6536791..6536893 542..644 230 81.6 Plus
chr2R 21145070 chr2R 6537034..6537136 299..401 230 81.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10648906..10649748 1..843 4215 100 Plus
2R 25286936 2R 10649204..10649306 542..644 230 81.6 Plus
2R 25286936 2R 10649447..10649549 299..401 230 81.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10650105..10650947 1..843 4215 100 Plus
Blast to na_te.dros performed 2019-03-16 01:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6810..6996 416..608 177 56.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6732..6888 452..614 162 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2509 452..611 161 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2559 416..632 156 55 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6934 416..630 149 53.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6862 477..615 139 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6739..6858 414..533 133 59.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6798..6946 416..570 131 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6760..6876 414..533 125 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2404 452..533 124 63.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2594..2684 414..506 118 61.7 Plus
roo 9092 roo DM_ROO 9092bp 1065..1143 452..533 115 62.2 Plus

FI01130.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:18:36 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6536493..6537332 1..840 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:36:04 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..714 7..720 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:49:28 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..714 7..720 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:29 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..714 7..720 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:48:44 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..714 7..720 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:30:14 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..714 7..720 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:12:13 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..834 7..840 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:49:27 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 24..863 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:29 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 19..858 1..840 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:48:44 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 1..834 7..840 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:30:14 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
CG12934-RA 19..858 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:36 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10648906..10649745 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:36 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10648906..10649745 1..840 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:36 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10648906..10649745 1..840 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:29 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6536411..6537250 1..840 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:28:26 Download gff for FI01130.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10650105..10650944 1..840 100   Plus

FI01130.pep Sequence

Translation from 0 to 719

> FI01130.pep
IKMKAAIILALIGTVLTAPPVRVMPKPGSELDQYAHIFAKVRPPGQKHQN
MEIEFQPQHHNSLPSNQVNAEINHVEPKQPQYMEQSSSQVESRPPHTVDF
EIKPVEQKPPQRLEFEVKPQHEQNSPQGHLVSLGVKPVEQKPPQHLEVEI
KQQQQQHSSQNHQVELEIKQVEQKPPQHLEIEIKPVDQKPPHRVELEVQQ
QHHQNSAQGHLVSLGAVEQKQQHIDHELKNSHKIELEFV*

FI01130.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13771-PA 196 GF13771-PA 1..174 3..220 321 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20141-PA 259 GG20141-PA 1..238 3..239 682 66.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG12934-PB 237 CG12934-PB 1..237 3..239 1247 100 Plus
CG12934-PA 237 CG12934-PA 1..237 3..239 1247 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17300-PA 192 GL17300-PA 1..166 3..183 231 40.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24170-PA 192 GA24170-PA 1..166 3..183 220 39.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21227-PA 236 GM21227-PA 1..236 3..239 1017 92.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10749-PA 236 GD10749-PA 1..236 3..239 1021 92.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22220-PA 239 GJ22220-PA 1..191 3..199 142 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19335-PA 222 GK19335-PA 1..187 3..231 144 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12830-PA 266 GE12830-PA 1..245 3..239 893 78.9 Plus

FI01130.hyp Sequence

Translation from 0 to 719

> FI01130.hyp
IKMKAAIILALIGTVLTAPPVRVMPKPGSELDQYAHIFAKVRPPGQKHQN
MEIEFQPQHHNSLPSNQVNAEINHVEPKQPQYMEQSSSQVESRPPHTVDF
EIKPVEQKPPQRLEFEVKPQHEQNSPQGHLVSLGVKPVEQKPPQHLEVEI
KQQQQQHSSQNHQVELEIKQVEQKPPQHLEIEIKPVDQKPPHRVELEVQQ
QHHQNSAQGHLVSLGAVEQKQQHIDHELKNSHKIELEFV*

FI01130.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG12934-PB 237 CG12934-PB 1..237 3..239 1247 100 Plus
CG12934-PA 237 CG12934-PA 1..237 3..239 1247 100 Plus