Clone FI01133 Report

Search the DGRC for FI01133

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:11
Well:33
Vector:pOT2
Associated Gene/TranscriptCG34296-RA
Protein status:FI01133.pep: gold
Sequenced Size:429

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34296 2008-08-15 Release 5.9 accounting
CG34296 2008-12-18 5.12 accounting

Clone Sequence Records

FI01133.complete Sequence

429 bp assembled on 2008-08-04

GenBank Submission: BT044072.1

> FI01133.complete
GGGAACTCAGAATGAAGCTGGCCCTGCTCCTGATCCTCTGCTGTTGCCTC
ATCGGAATGGCGATTGGTGACTCGGTTTTGGTGACCAAGCCGCCGTTCAT
TCGCAGTCGCTATAGCTTGCGTTGGAGGAAGACAACCACTGTGGCGCCTG
AAGTGGTCACTGGATCCAGTGGATCAACCGTTAACACGGTCACCACCACC
GACCATCCCAAGCTGGCCACTTCCACCGCCAGTTCGGATTACGACTATTA
CGGAAATGGGGAGACGGAGAATGTGGTGCACAAGTAATAGTCATATTCCA
GCCATATGACTATATATTAACACTTGATATAATCAGAGCGACTTTAATGT
CATAACAATGTAAGAGAAGGCCATTTAATAAATAAACTGTATGTCAAATC
TCTAGAAATCAAAAAAAAAAAAAAAAAAA

FI01133.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-RA 501 CG34296-RA 59..477 1..419 2065 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25545268..25545621 60..410 1660 98.6 Plus
chr3R 27901430 chr3R 25545153..25545212 1..60 300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29722663..29723022 60..419 1770 99.4 Plus
3R 32079331 3R 29722548..29722607 1..60 300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29463494..29463853 60..419 1770 99.4 Plus
3R 31820162 3R 29463379..29463438 1..60 300 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:12:15 has no hits.

FI01133.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:17 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25545153..25545212 1..60 100 -> Plus
chr3R 25545269..25545614 61..403 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:36:15 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 1..276 12..287 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:38 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 1..276 12..287 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:18 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 1..276 12..287 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:33 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 1..276 12..287 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:01:10 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 1..276 12..287 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:26 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 7..416 1..410 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:38 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 7..416 1..410 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:18 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 11..420 1..410 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-05 13:35:17 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 7..416 1..410 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:01:10 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 11..420 1..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:17 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29722548..29722607 1..60 100 -> Plus
3R 29722664..29723013 61..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:17 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29722548..29722607 1..60 100 -> Plus
3R 29722664..29723013 61..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:17 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29722548..29722607 1..60 100 -> Plus
3R 29722664..29723013 61..410 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:18 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25548270..25548329 1..60 100 -> Plus
arm_3R 25548386..25548735 61..410 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:42 Download gff for FI01133.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29463495..29463844 61..410 100   Plus
3R 29463379..29463438 1..60 100 -> Plus

FI01133.hyp Sequence

Translation from 2 to 286

> FI01133.hyp
ELRMKLALLLILCCCLIGMAIGDSVLVTKPPFIRSRYSLRWRKTTTVAPE
VVTGSSGSTVNTVTTTDHPKLATSTASSDYDYYGNGETENVVHK*

FI01133.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-PA 91 CG34296-PA 1..91 4..94 473 100 Plus

FI01133.pep Sequence

Translation from 2 to 286

> FI01133.pep
ELRMKLALLLILCCCLIGMAIGDSVLVTKPPFIRSRYSLRWRKTTTVAPE
VVTGSSGSTVNTVTTTDHPKLATSTASSDYDYYGNGETENVVHK*

FI01133.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23364-PA 86 GF23364-PA 1..86 4..94 240 60.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11683-PA 90 GG11683-PA 1..90 4..94 294 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14319-PA 89 GH14319-PA 1..89 4..94 293 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-PA 91 CG34296-PA 1..91 4..94 473 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13906-PA 84 GL13906-PA 1..84 4..94 247 59.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26962-PA 84 GA26962-PA 1..84 4..94 247 59.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12808-PA 91 GM12808-PA 1..91 4..94 380 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21454-PA 91 GD21454-PA 1..91 4..94 386 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10631-PA 88 GJ10631-PA 1..88 4..94 228 61.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11914-PA 351 GK11914-PA 288..348 28..94 207 58.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23873-PA 91 GE23873-PA 1..91 4..94 363 87.9 Plus