BDGP Sequence Production Resources |
Search the DGRC for FI01133
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 11 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34296-RA |
Protein status: | FI01133.pep: gold |
Sequenced Size: | 429 |
Gene | Date | Evidence |
---|---|---|
CG34296 | 2008-08-15 | Release 5.9 accounting |
CG34296 | 2008-12-18 | 5.12 accounting |
429 bp assembled on 2008-08-04
GenBank Submission: BT044072.1
> FI01133.complete GGGAACTCAGAATGAAGCTGGCCCTGCTCCTGATCCTCTGCTGTTGCCTC ATCGGAATGGCGATTGGTGACTCGGTTTTGGTGACCAAGCCGCCGTTCAT TCGCAGTCGCTATAGCTTGCGTTGGAGGAAGACAACCACTGTGGCGCCTG AAGTGGTCACTGGATCCAGTGGATCAACCGTTAACACGGTCACCACCACC GACCATCCCAAGCTGGCCACTTCCACCGCCAGTTCGGATTACGACTATTA CGGAAATGGGGAGACGGAGAATGTGGTGCACAAGTAATAGTCATATTCCA GCCATATGACTATATATTAACACTTGATATAATCAGAGCGACTTTAATGT CATAACAATGTAAGAGAAGGCCATTTAATAAATAAACTGTATGTCAAATC TCTAGAAATCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34296-RA | 501 | CG34296-RA | 59..477 | 1..419 | 2065 | 99.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25545153..25545212 | 1..60 | 100 | -> | Plus |
chr3R | 25545269..25545614 | 61..403 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 1..276 | 12..287 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 1..276 | 12..287 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 1..276 | 12..287 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 1..276 | 12..287 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 1..276 | 12..287 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 7..416 | 1..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 7..416 | 1..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 11..420 | 1..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 7..416 | 1..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34296-RA | 11..420 | 1..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29722548..29722607 | 1..60 | 100 | -> | Plus |
3R | 29722664..29723013 | 61..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29722548..29722607 | 1..60 | 100 | -> | Plus |
3R | 29722664..29723013 | 61..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29722548..29722607 | 1..60 | 100 | -> | Plus |
3R | 29722664..29723013 | 61..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25548270..25548329 | 1..60 | 100 | -> | Plus |
arm_3R | 25548386..25548735 | 61..410 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29463495..29463844 | 61..410 | 100 | Plus | |
3R | 29463379..29463438 | 1..60 | 100 | -> | Plus |
Translation from 2 to 286
> FI01133.hyp ELRMKLALLLILCCCLIGMAIGDSVLVTKPPFIRSRYSLRWRKTTTVAPE VVTGSSGSTVNTVTTTDHPKLATSTASSDYDYYGNGETENVVHK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34296-PA | 91 | CG34296-PA | 1..91 | 4..94 | 473 | 100 | Plus |
Translation from 2 to 286
> FI01133.pep ELRMKLALLLILCCCLIGMAIGDSVLVTKPPFIRSRYSLRWRKTTTVAPE VVTGSSGSTVNTVTTTDHPKLATSTASSDYDYYGNGETENVVHK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23364-PA | 86 | GF23364-PA | 1..86 | 4..94 | 240 | 60.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11683-PA | 90 | GG11683-PA | 1..90 | 4..94 | 294 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14319-PA | 89 | GH14319-PA | 1..89 | 4..94 | 293 | 58.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34296-PA | 91 | CG34296-PA | 1..91 | 4..94 | 473 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13906-PA | 84 | GL13906-PA | 1..84 | 4..94 | 247 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26962-PA | 84 | GA26962-PA | 1..84 | 4..94 | 247 | 59.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12808-PA | 91 | GM12808-PA | 1..91 | 4..94 | 380 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21454-PA | 91 | GD21454-PA | 1..91 | 4..94 | 386 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10631-PA | 88 | GJ10631-PA | 1..88 | 4..94 | 228 | 61.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11914-PA | 351 | GK11914-PA | 288..348 | 28..94 | 207 | 58.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23873-PA | 91 | GE23873-PA | 1..91 | 4..94 | 363 | 87.9 | Plus |