Clone FI01135 Report

Search the DGRC for FI01135

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:11
Well:35
Vector:pOT2
Associated Gene/TranscriptCG9624-RA
Protein status:FI01135.pep: Imported from assembly
Sequenced Size:945

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9624 2008-12-18 5.12 accounting

Clone Sequence Records

FI01135.complete Sequence

945 bp assembled on 2008-10-12

GenBank Submission: BT046125.1

> FI01135.complete
GCAACGGAAATTCTGCCATAGACACACATTTGCTAGCCAGGCCAAATTAC
ATGAATAGAAATTCCAAGTACCCAAAATGAATACCTCCGAAGTCAAACGA
ACGCTGGGTAGCCCCTTCTTCGACGTGCTATGGCCATTGATCCTGGACGA
GAATGTCTGTCGCATCGAGACCAAGCCGGACGAATTCTTTGTGCCCCGGC
AGCCCTTCAATCGACTGGATTGGCATATCTATCTGTCCCAGGTGGGCTTT
CCTTTCTACATGCCGCCACATGAGCTGCGCTGCTGCAAAGGAGCCCAAAG
GGAGGAGATCGAGAACGAGGATGCTGAGAATGCCTTAAACCAGGAGGTGG
AGGAGCGAACGGCGTCGAATCAGGTGGACTTTCTGCGCCATGGATCCCGG
GACATTAGACCCATAGATGAGGTGGTAAACAAACTGAGGATGGAGCAGGA
GCGTCGCCAGAAGTTGGCGTACGACTTTGCCAATCGGCGCTATCCTTGGA
CCATGCAAACTCCCAGTCACGAACTGGGCTTCACCATCACTGAGGAGCTG
CAGAAGTGCTTCAAGGGACCCATGGAGCTGGACATCTTGAGGGCCATTCA
TGATCACGACTGCAAGCTAATGATTATCGATCTGGGCACTGATGTGGACA
TTAAGGACTGCCAGCGCTGGATAAAGTTTCGTCCATATATTCAGTTACTG
GCATTGCCCCGAACACCTCGCATGGAACGATCGCTTCAGGTGCTCAATGT
CTTCCACACGTATTTGGTGGAAGAATCGGCTGATAACTCATGGCACGATG
AGGTGCAATACTCCCTTCGCACAGCTTTTGTGCACGCACAGAAAAATCAG
CTCCTTAAGTCCTGCGGAGAGCCATTTGTCTTCGTATTTAGTCGTTTTCG
TGGCATCTGCACCTGCGATACCTATAAGATAATCCGACGGGCATA

FI01135.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9624-RA 961 CG9624-RA 16..960 1..945 4710 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10053075..10054018 944..1 4615 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14228201..14229145 945..1 4710 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13969032..13969976 945..1 4710 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 21:42:02 has no hits.

FI01135.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:43:23 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10053075..10054018 1..944 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:36:22 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 1..868 77..944 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:09 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 1..868 77..944 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:00:15 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 1..869 77..945 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:28:38 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 1..869 77..945 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:53:56 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 16..959 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:09 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 16..959 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:00:15 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 16..959 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-12 16:27:44 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 16..959 1..944 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:28:38 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
CG9624-RA 1..944 1..944 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:43:23 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14228202..14229145 1..944 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:43:23 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14228202..14229145 1..944 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:43:23 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14228202..14229145 1..944 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:00:15 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10053924..10054867 1..944 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:45:56 Download gff for FI01135.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13969033..13969976 1..944 99   Minus

FI01135.pep Sequence

Translation from 76 to 943

> FI01135.pep
MNTSEVKRTLGSPFFDVLWPLILDENVCRIETKPDEFFVPRQPFNRLDWH
IYLSQVGFPFYMPPHELRCCKGAQREEIENEDAENALNQEVEERTASNQV
DFLRHGSRDIRPIDEVVNKLRMEQERRQKLAYDFANRRYPWTMQTPSHEL
GFTITEELQKCFKGPMELDILRAIHDHDCKLMIIDLGTDVDIKDCQRWIK
FRPYIQLLALPRTPRMERSLQVLNVFHTYLVEESADNSWHDEVQYSLRTA
FVHAQKNQLLKSCGEPFVFVFSRFRGICTCDTYKIIRRA

FI01135.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18775-PA 304 GF18775-PA 24..303 9..288 1063 69.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21406-PA 289 GG21406-PA 1..289 1..289 1366 86.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19681-PA 296 GH19681-PA 15..296 8..289 791 51.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9624-PA 289 CG9624-PA 1..289 1..289 1560 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24537-PA 297 GI24537-PA 16..297 8..289 785 51.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23294-PA 280 GL23294-PA 1..279 10..288 868 60.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21921-PA 280 GA21921-PA 1..279 10..288 875 60.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25868-PA 289 GM25868-PA 1..289 1..289 1486 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20438-PA 289 GD20438-PA 1..289 1..289 1505 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22604-PA 294 GJ22604-PA 8..293 2..288 807 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10895-PA 296 GK10895-PA 18..296 9..289 820 54.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10044-PA 289 GE10044-PA 1..289 1..289 1372 87.2 Plus

FI01135.hyp Sequence

Translation from 76 to 943

> FI01135.hyp
MNTSEVKRTLGSPFFDVLWPLILDENVCRIETKPDEFFVPRQPFNRLDWH
IYLSQVGFPFYMPPHELRCCKGAQREEIENEDAENALNQEVEERTASNQV
DFLRHGSRDIRPIDEVVNKLRMEQERRQKLAYDFANRRYPWTMQTPSHEL
GFTITEELQKCFKGPMELDILRAIHDHDCKLMIIDLGTDVDIKDCQRWIK
FRPYIQLLALPRTPRMERSLQVLNVFHTYLVEESADNSWHDEVQYSLRTA
FVHAQKNQLLKSCGEPFVFVFSRFRGICTCDTYKIIRRA

FI01135.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 06:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9624-PA 289 CG9624-PA 1..289 1..289 1560 100 Plus