Clone FI01407 Report

Search the DGRC for FI01407

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:7
Vector:pFlc-1
Associated Gene/TranscriptCG13901-RA
Protein status:FI01407.pep: gold
Sequenced Size:863

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13901 2008-04-29 Release 5.5 accounting
CG13901 2008-08-15 Release 5.9 accounting
CG13901 2008-12-18 5.12 accounting

Clone Sequence Records

FI01407.complete Sequence

863 bp assembled on 2007-09-05

GenBank Submission: BT030766

> FI01407.complete
AGTTGTTATATTCGAATCTCCGGCGGAGACGTGTGCCTAGGTAATCCCAT
CAATCCCCAGAGATGTCCTACCAGAACTGGCTAAACTACCTGCAGGCGGC
GGAGAAGAACTCCATGATAAGTGGCCGCGCCCGCAAGGTGCTCTACAAAT
TCCCGGACGGCAGGCAAATGGCCGAGGAGTACAACATGGACACGGGAATC
GTGCAGCGGCGGGCCTGGAAATCGAAGAGCAACAAGATCATGGGCGAGTC
GGAGTGGGAAATCGAGCTGGGCGATGAGCCGCGTCAGTTAAACTGGTCGG
GCAACAAGCCACCAGGATCTGGCGAGGAAACGGACTCCCTGGCCGGCGGA
GATTTCACCCTGCGGGAGAGCAACACCGCGCCACTGCTGACCAAGCGGAT
CACCAAGAAGAACATTGAGTGGCGCATCCGCAACATGCCCTACTCCCTGG
ACACATACAGCGTAACCGCCGATCCCGAGAAGCGTGCCATAGTCGTGCGC
ACCTCGAACAAGAAGTACTACAAGGTCATCCCGGTCCCGGAACTGGACCG
CTGTGGGGTCAAGCCCGCGCAGGAGAGCCTCTCTGTCCACCACCAGTTCA
ACACGCTGATCATTACCTACCAGAAACCAGATATCCTCTGCGAGATGGAG
GCACAGGTGCTGCTTCTGCTCAAGAATGTCGACACCGAAACCGACATGGA
TGATCTGCTGAAGGGTCTGATGGCCAAATAAACGACTTAGATTGTAATAC
ACAAAGTATTATTATTATTATTATTATTGTGAATTAACCTAATTTAATTT
ATTTAGAGAATTCCCAAATACACTTCACAAAGGGAACTGCAAAAAACAAA
AAAAAAAAAAAAA

FI01407.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13901-RA 848 CG13901-RA 2..848 1..847 4220 99.8 Plus
CG13901.a 881 CG13901.a 70..812 1..743 3715 100 Plus
CG42554-RA 998 CG42554-RA 955..998 847..804 205 97.7 Minus
CG13901.a 881 CG13901.a 813..853 807..847 190 97.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 836448..837294 847..1 4220 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 836667..837513 847..1 4220 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 836667..837513 847..1 4220 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 19:33:18 has no hits.

FI01407.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:34:32 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 836448..837294 1..847 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:04 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 1..669 63..731 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:51 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 1..669 63..731 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:59:03 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 1..669 63..731 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:18 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 1..669 63..731 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:51 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 1..669 63..731 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:36 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 2..848 1..847 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:51 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 2..848 1..847 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:03 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 65..911 1..847 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:18 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 2..848 1..847 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:51 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
CG13901-RA 65..911 1..847 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:32 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
3L 836667..837513 1..847 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:32 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
3L 836667..837513 1..847 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:32 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
3L 836667..837513 1..847 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:03 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 836667..837513 1..847 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:39 Download gff for FI01407.complete
Subject Subject Range Query Range Percent Splice Strand
3L 836667..837513 1..847 99   Minus

FI01407.hyp Sequence

Translation from 62 to 730

> FI01407.hyp
MSYQNWLNYLQAAEKNSMISGRARKVLYKFPDGRQMAEEYNMDTGIVQRR
AWKSKSNKIMGESEWEIELGDEPRQLNWSGNKPPGSGEETDSLAGGDFTL
RESNTAPLLTKRITKKNIEWRIRNMPYSLDTYSVTADPEKRAIVVRTSNK
KYYKVIPVPELDRCGVKPAQESLSVHHQFNTLIITYQKPDILCEMEAQVL
LLLKNVDTETDMDDLLKGLMAK*

FI01407.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13901-PB 222 CG13901-PB 1..222 1..222 1164 100 Plus
CG13901-PA 222 CG13901-PA 1..222 1..222 1164 100 Plus

FI01407.pep Sequence

Translation from 62 to 730

> FI01407.pep
MSYQNWLNYLQAAEKNSMISGRARKVLYKFPDGRQMAEEYNMDTGIVQRR
AWKSKSNKIMGESEWEIELGDEPRQLNWSGNKPPGSGEETDSLAGGDFTL
RESNTAPLLTKRITKKNIEWRIRNMPYSLDTYSVTADPEKRAIVVRTSNK
KYYKVIPVPELDRCGVKPAQESLSVHHQFNTLIITYQKPDILCEMEAQVL
LLLKNVDTETDMDDLLKGLMAK*

FI01407.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25025-PA 221 GF25025-PA 1..221 1..222 1019 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14634-PA 222 GG14634-PA 1..222 1..222 1152 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16028-PA 225 GH16028-PA 1..225 1..222 932 77.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13901-PB 222 CG13901-PB 1..222 1..222 1164 100 Plus
CG13901-PA 222 CG13901-PA 1..222 1..222 1164 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12292-PA 223 GI12292-PA 1..223 1..222 917 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16338-PA 220 GL16338-PA 1..220 1..222 925 76.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12612-PA 222 GA12612-PA 1..222 1..222 889 76.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14249-PA 222 GM14249-PA 1..222 1..222 1166 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13506-PA 222 GD13506-PA 1..222 1..222 1173 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13229-PA 223 GJ13229-PA 1..223 1..222 958 78.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11888-PA 220 GK11888-PA 1..220 1..222 956 78.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20992-PA 222 GE20992-PA 1..222 1..222 1149 95.5 Plus