Clone FI01416 Report

Search the DGRC for FI01416

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG13551-RA
Protein status:FI01416.pep: gold
Sequenced Size:609

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13551 2008-04-29 Release 5.5 accounting
CG13551 2008-08-15 Release 5.9 accounting
CG13551 2008-12-18 5.12 accounting

Clone Sequence Records

FI01416.complete Sequence

609 bp assembled on 2007-09-04

GenBank Submission: BT030768

> FI01416.complete
ATTATTTAAGGGTGCGCCTACGGTCACTCTGCAGAAAACTTTTGTCGTCG
CAAAAATCTAAACTACTCAAGAATCAAACAGAATGTTCGTTGTACGTCGT
AGCGCATCTCGTCTGTACCCCGCTGGAGTCCAGCTGGCCAAGATGAGCGG
CAGCCAGGTGGGCGACCTAGGCAGTGGCGCCGGCAAGGGAGGCGGCGGCG
GTGGCTCTATCCGCGAGGCCGGCGGAGCCTTCGGCAAGCTTGAGGCTGCC
CGCGAGGAGGAGTACTTCTACAAGAAGCAAAGGGAGCAGCTGGATCGCCT
TAAGAACGACCAGATCCACCAGGCTGAGTTCCACCACCAGCAGATCAAGG
AGCACGAGGAGGCCATCCAGCGCCACAAGGAGTTCCTCGAGAACCTGCAC
AAGTGAGCGGTGATCCATCCACCGGCAGAAGGCGACCGCACGGACGGATG
AACTCGAGACATTTACTAAAATGCATTTCACTCTCTTTTGTATGTTCCCA
AGTGCTCACTACCACTTACCAGTAACCCAAAAATTATATATGTATTTGAA
AAGTGCGTAATAAACCATCCATATTTTGAATGCTTTAACAAGAAAAAAAA
AAAAAAAAA

FI01416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13551-RA 689 CG13551-RA 30..623 1..594 2955 99.8 Plus
CG13551-RB 699 CG13551-RB 97..633 58..594 2670 99.8 Plus
CG13551-RC 704 CG13551-RC 242..703 133..594 2295 99.7 Plus
CG13551-RB 699 CG13551-RB 1..55 7..61 260 98.1 Plus
CG13551-RC 704 CG13551-RC 208..242 58..92 175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19264184..19264497 589..276 1570 100 Minus
chr2R 21145070 chr2R 19268933..19269077 277..133 725 100 Minus
chr2R 21145070 chr2R 19269365..19269440 133..58 380 100 Minus
chr2R 21145070 chr2R 19269679..19269739 61..1 290 98.4 Minus
chr2R 21145070 chr2R 19245178..19245282 170..274 270 83.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23377861..23378179 594..276 1580 99.7 Minus
2R 25286936 2R 23382615..23382759 277..133 725 100 Minus
2R 25286936 2R 23383047..23383122 133..58 380 100 Minus
2R 25286936 2R 23383361..23383421 61..1 290 98.4 Minus
2R 25286936 2R 23358864..23358968 170..274 270 83.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23379060..23379378 594..276 1580 99.6 Minus
2R 25260384 2R 23383814..23383958 277..133 725 100 Minus
2R 25260384 2R 23384246..23384321 133..58 380 100 Minus
2R 25260384 2R 23384560..23384620 61..1 290 98.3 Minus
2R 25260384 2R 23360063..23360167 170..274 270 83.8 Plus
Blast to na_te.dros performed on 2019-03-17 00:15:56 has no hits.

FI01416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:16:53 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19264181..19264495 278..592 99 <- Minus
chr2R 19268933..19269077 133..277 100 <- Minus
chr2R 19269366..19269440 58..132 100 <- Minus
chr2R 19269683..19269739 1..57 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:12 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RB 1..324 83..406 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:27 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RB 1..324 83..406 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:34:57 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 1..324 83..406 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:42:53 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RB 1..324 83..406 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:17:08 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 1..324 83..406 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:19 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 1..592 1..592 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:27 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 1..592 1..592 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:34:57 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 4..592 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:42:53 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 1..592 1..592 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:08 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
CG13551-RA 4..592 1..589 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:53 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23377863..23378177 278..592 99 <- Minus
2R 23382615..23382759 133..277 100 <- Minus
2R 23383048..23383122 58..132 100 <- Minus
2R 23383365..23383421 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:53 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23377863..23378177 278..592 99 <- Minus
2R 23382615..23382759 133..277 100 <- Minus
2R 23383048..23383122 58..132 100 <- Minus
2R 23383365..23383421 1..57 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:53 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23377863..23378177 278..592 99 <- Minus
2R 23382615..23382759 133..277 100 <- Minus
2R 23383048..23383122 58..132 100 <- Minus
2R 23383365..23383421 1..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:34:57 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19270138..19270282 133..277 100 <- Minus
arm_2R 19270571..19270645 58..132 100 <- Minus
arm_2R 19270888..19270944 1..57 100   Minus
arm_2R 19265386..19265700 278..592 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:12 Download gff for FI01416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23383832..23383976 133..277 100 <- Minus
2R 23384265..23384339 58..132 100 <- Minus
2R 23384582..23384638 1..57 100   Minus
2R 23379080..23379394 278..592 99 <- Minus

FI01416.hyp Sequence

Translation from 82 to 405

> FI01416.hyp
MFVVRRSASRLYPAGVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAF
GKLEAAREEEYFYKKQREQLDRLKNDQIHQAEFHHQQIKEHEEAIQRHKE
FLENLHK*

FI01416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13551-PB 107 CG13551-PB 1..107 1..107 554 100 Plus
CG13551-PA 107 CG13551-PA 1..107 1..107 554 100 Plus
CG34423-PB 85 CG34423-PB 1..72 1..74 260 68.9 Plus
CG34423-PA 65 CG34423-PA 2..52 24..74 224 80.4 Plus

FI01416.pep Sequence

Translation from 82 to 405

> FI01416.pep
MFVVRRSASRLYPAGVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAF
GKLEAAREEEYFYKKQREQLDRLKNDQIHQAEFHHQQIKEHEEAIQRHKE
FLENLHK*

FI01416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13051-PA 106 GF13051-PA 1..106 1..107 430 94.4 Plus
Dana\GF13139-PA 82 GF13139-PA 2..70 24..91 150 65.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20040-PA 107 GG20040-PA 1..107 1..107 532 98.1 Plus
Dere\GG22845-PA 81 GG22845-PA 2..52 24..74 139 80.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20671-PA 106 GH20671-PA 1..106 1..107 427 90.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13551-PB 107 CG13551-PB 1..107 1..107 554 100 Plus
CG13551-PA 107 CG13551-PA 1..107 1..107 554 100 Plus
CG34423-PB 85 CG34423-PB 1..72 1..74 260 68.9 Plus
CG34423-PA 65 CG34423-PA 2..52 24..74 224 80.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19031-PA 107 GI19031-PA 1..107 1..107 450 95.3 Plus
Dmoj\GI20012-PA 85 GI20012-PA 1..73 1..75 184 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16907-PA 106 GL16907-PA 1..106 1..107 420 88.8 Plus
Dper\GL11441-PA 227 GL11441-PA 2..53 24..75 139 78.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12357-PA 106 GA12357-PA 1..106 1..107 420 88.8 Plus
Dpse\GA12357-PB 86 GA12357-PB 2..86 23..107 323 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15553-PA 107 GM15553-PA 1..107 1..107 536 98.1 Plus
Dsec\GM16002-PA 318 GM16002-PA 2..53 24..75 145 80.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25056-PA 107 GD25056-PA 1..107 1..107 541 100 Plus
Dsim\GD11755-PA 223 GD11755-PA 1..73 1..75 187 69.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19999-PA 107 GJ19999-PA 1..107 1..107 404 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22919-PA 107 GK22919-PA 1..107 1..107 447 93.5 Plus
Dwil\GK22917-PA 85 GK22917-PA 1..79 1..81 185 64.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11575-PA 107 GE11575-PA 1..107 1..107 532 98.1 Plus
Dyak\GE14281-PA 82 GE14281-PA 2..53 24..75 139 78.8 Plus