Clone FI01417 Report

Search the DGRC for FI01417

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:17
Vector:pFlc-1
Associated Gene/TranscriptTpnC47D-RA
Protein status:FI01417.pep: gold
Sequenced Size:626

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
TpnC47D 2008-04-29 Release 5.5 accounting
TpnC47D 2008-08-15 Release 5.9 accounting
TpnC47D 2008-12-18 5.12 accounting

Clone Sequence Records

FI01417.complete Sequence

626 bp assembled on 2007-09-04

GenBank Submission: BT030769

> FI01417.complete
TGGGACTGATTCAGTCGTTAGCGGTGATCGATCTGGTGAACAACTAGCAC
AGGATTTAAAATGGATAACATTGACGAAGACCTGACCCCCGAGCAGATTG
CCGTTCTGCAGAAGGCATTCAACAGCTTCGACCACCAGAAGACCGGCAGT
ATCCCCACCGAAATGGTGGCCGATATCCTCCGTCTTATGGGTCAGCCCTT
CGACAGGCAGATCCTTGACGAGCTGATCGACGAGGTCGATGAGGACAAAT
CCGGTCGCCTGGAGTTCGAGGAGTTCGTCCAGCTGGCTGCCAAGTTCATC
GTAGAGGAGGATGATGAGGCCATGCAGAAGGAGCTGCGCGAGGCTTTCCG
TCTGTACGACAAGCAGGGCAATGGCTACATTCCCACCTCCTGCCTGAAGG
AGATCCTCAAGGAACTGGACGACCAGCTGACCGAACAGGAGCTCGACATC
ATGATTGAGGAAATCGATTCCGACGGCTCTGGCACCGTTGATTTTGATGA
ATTCATGGAGATGATGACTGGCGAGTAAGCATTGTGGACCCAACGTATCT
CATAATTGTCTACCCCCCAACACCCGAGGCTTGAATAAACGTTTTGTATT
TTATTTCCAAAAAAAAAAAAAAAAAA

FI01417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC47D.a 1262 TpnC47D.a 506..1108 5..607 3015 100 Plus
TpnC47D-RA 912 TpnC47D-RA 156..758 5..607 3015 100 Plus
TpnC73F-RB 2178 TpnC73F-RB 1140..1389 250..499 905 90.8 Plus
TpnC73F-RB 2178 TpnC73F-RB 196..367 76..247 485 85.4 Plus
TpnC73F-RB 2178 TpnC73F-RB 1752..1781 499..528 150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7162043..7162294 499..248 1260 100 Minus
chr3L 24539361 chr3L 17036815..17037064 250..499 905 90.8 Plus
chr2R 21145070 chr2R 7162353..7162527 247..73 875 100 Minus
chr2R 21145070 chr2R 7161495..7161603 607..499 545 100 Minus
chr2R 21145070 chr2R 7162683..7162751 73..5 330 98.6 Minus
chr3L 24539361 chr3L 17035808..17035924 76..192 315 84.6 Plus
chr3L 24539361 chr3L 17035986..17036043 190..247 200 89.7 Plus
chr2L 23010047 chr2L 5217751..5217873 286..408 195 77.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11274580..11274831 499..248 1260 100 Minus
3L 28110227 3L 17047352..17047601 250..499 905 90.8 Plus
2R 25286936 2R 11274890..11275064 247..73 875 100 Minus
2R 25286936 2R 11274035..11274143 607..499 545 100 Minus
2R 25286936 2R 11275220..11275288 73..5 345 100 Minus
3L 28110227 3L 17046344..17046460 76..192 300 83.8 Plus
3L 28110227 3L 17046522..17046579 190..247 200 89.7 Plus
2L 23513712 2L 5218651..5218773 286..408 195 77.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11275779..11276030 499..248 1260 100 Minus
3L 28103327 3L 17040452..17040701 250..499 905 90.8 Plus
2R 25260384 2R 11276089..11276263 247..73 875 100 Minus
2R 25260384 2R 11275234..11275342 607..499 545 100 Minus
2R 25260384 2R 11276419..11276487 73..5 345 100 Minus
3L 28103327 3L 17039444..17039560 76..192 300 83.7 Plus
3L 28103327 3L 17039622..17039679 190..247 200 89.6 Plus
2L 23513712 2L 5218651..5218773 286..408 195 77.2 Plus
3L 28103327 3L 17041064..17041093 499..528 150 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:04:55 has no hits.

FI01417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:06:07 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7162353..7162527 73..247 100 <- Minus
chr2R 7162684..7162754 1..72 95   Minus
chr2R 7161494..7161602 500..608 99 <- Minus
chr2R 7162043..7162294 248..499 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:15 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..468 61..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:29 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..468 61..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:25 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..468 61..528 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:42:54 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..468 61..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:45 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..468 61..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:23 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..605 3..606 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:29 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..606 3..607 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:25 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..601 7..607 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:42:54 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..605 3..606 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:45 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 1..601 7..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:07 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11274034..11274142 500..608 99 <- Minus
2R 11274580..11274831 248..499 100 <- Minus
2R 11274890..11275064 73..247 100 <- Minus
2R 11275221..11275291 1..72 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:07 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11274034..11274142 500..608 99 <- Minus
2R 11274580..11274831 248..499 100 <- Minus
2R 11274890..11275064 73..247 100 <- Minus
2R 11275221..11275291 1..72 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:07 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11274034..11274142 500..608 99 <- Minus
2R 11274580..11274831 248..499 100 <- Minus
2R 11274890..11275064 73..247 100 <- Minus
2R 11275221..11275291 1..72 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:25 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7161539..7161647 500..608 99 <- Minus
arm_2R 7162085..7162336 248..499 100 <- Minus
arm_2R 7162395..7162569 73..247 100 <- Minus
arm_2R 7162726..7162796 1..72 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:13 Download gff for FI01417.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11276089..11276263 73..247 100 <- Minus
2R 11276420..11276490 1..72 97   Minus
2R 11275779..11276030 248..499 100 <- Minus
2R 11275233..11275341 500..608 99 <- Minus

FI01417.pep Sequence

Translation from 60 to 527

> FI01417.pep
MDNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQ
ILDELIDEVDEDKSGRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYD
KQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFME
MMTGE*

FI01417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12423-PA 155 GF12423-PA 1..155 1..155 757 94.8 Plus
Dana\GF10103-PA 155 GF10103-PA 1..155 1..155 737 92.3 Plus
Dana\GF13927-PA 173 GF13927-PA 25..170 8..154 478 63.9 Plus
Dana\GF14383-PA 143 GF14383-PA 3..143 15..155 415 59.6 Plus
Dana\GF13971-PA 161 GF13971-PA 10..161 5..155 404 52 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22682-PA 155 GG22682-PA 1..155 1..155 787 100 Plus
Dere\GG13604-PA 155 GG13604-PA 1..155 1..155 741 92.9 Plus
Dere\GG10878-PA 289 GG10878-PA 138..286 6..154 492 65.1 Plus
Dere\GG25060-PA 143 GG25060-PA 3..143 15..155 412 59.6 Plus
Dere\GG10858-PA 158 GG10858-PA 3..153 5..154 402 52.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21939-PA 154 GH21939-PA 2..154 3..155 738 94.1 Plus
Dgri\GH16402-PA 155 GH16402-PA 1..155 1..155 737 92.3 Plus
Dgri\GH21731-PA 152 GH21731-PA 1..149 6..154 498 65.8 Plus
Dgri\GH21490-PA 143 GH21490-PA 3..143 15..155 405 58.2 Plus
Dgri\GH21732-PA 154 GH21732-PA 9..153 11..154 378 52.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC47D-PB 155 CG9073-PB 1..155 1..155 788 100 Plus
TpnC47D-PA 155 CG9073-PA 1..155 1..155 788 100 Plus
TpnC73F-PC 155 CG7930-PC 1..155 1..155 739 92.9 Plus
TpnC73F-PA 155 CG7930-PA 1..155 1..155 739 92.9 Plus
TpnC41C-PB 154 CG2981-PB 1..151 4..154 498 64.2 Plus
TpnC41C-PA 154 CG2981-PA 1..151 4..154 498 64.2 Plus
TpnC25D-PC 149 CG6514-PC 5..149 11..155 425 58.6 Plus
TpnC25D-PA 149 CG6514-PA 5..149 11..155 425 58.6 Plus
TpnC25D-PB 143 CG6514-PB 3..143 15..155 420 59.6 Plus
TpnC4-PB 153 CG12408-PB 3..153 5..154 408 53 Plus
TpnC4-PA 153 CG12408-PA 3..153 5..154 408 53 Plus
Cam-PD 149 CG8472-PD 3..149 6..155 305 40 Plus
Cam-PC 149 CG8472-PC 3..149 6..155 305 40 Plus
Cam-PE 149 CG8472-PE 3..149 6..155 305 40 Plus
Cam-PB 149 CG8472-PB 3..149 6..155 305 40 Plus
Cam-PA 149 CG8472-PA 3..149 6..155 305 40 Plus
Acam-PB 148 CG17769-PB 3..146 7..153 269 37.4 Plus
Acam-PA 148 CG17769-PA 3..146 7..153 269 37.4 Plus
CG11638-PA 387 CG11638-PA 210..355 12..152 249 34.9 Plus
CG31960-PA 148 CG31960-PA 2..146 6..153 228 31.8 Plus
CG31802-PA 186 CG31802-PA 38..180 7..152 226 34.2 Plus
azot-PA 148 CG11165-PA 2..146 6..153 223 34.2 Plus
CG17493-PD 182 CG17493-PD 34..176 7..152 219 33.6 Plus
CG17493-PC 182 CG17493-PC 34..176 7..152 219 33.6 Plus
CG17493-PB 182 CG17493-PB 34..176 7..152 219 33.6 Plus
CG17770-PA 164 CG17770-PA 19..162 7..153 202 33.8 Plus
CG5024-PB 165 CG5024-PB 21..162 8..152 186 28.3 Plus
CG5024-PA 165 CG5024-PA 21..162 8..152 186 28.3 Plus
CG30378-PA 148 CG30378-PA 5..146 8..152 182 22.8 Plus
CanB2-PB 170 CG11217-PB 18..157 11..152 168 30.6 Plus
CanB2-PA 170 CG11217-PA 18..157 11..152 168 30.6 Plus
Mlc-c-PA 147 CG3201-PA 5..144 9..152 166 27.1 Plus
CanB-PB 170 CG4209-PB 18..157 11..152 164 30.6 Plus
CanB-PA 170 CG4209-PA 18..157 11..152 164 30.6 Plus
Eip63F-1-PD 166 CG15855-PD 1..165 4..152 152 23.6 Plus
Mlc-c-PB 153 CG3201-PB 19..150 17..152 151 26.5 Plus
Eip63F-1-PC 181 CG15855-PC 21..180 9..152 151 24.4 Plus
Eip63F-1-PA 193 CG15855-PA 33..192 9..152 151 24.4 Plus
Eip63F-1-PB 161 CG15855-PB 8..160 16..152 147 24.2 Plus
CG13526-PA 154 CG13526-PA 8..150 7..152 145 24.7 Plus
sqh-PE 174 CG3595-PE 32..164 12..152 142 26.2 Plus
sqh-PD 174 CG3595-PD 32..164 12..152 142 26.2 Plus
sqh-PC 174 CG3595-PC 32..164 12..152 142 26.2 Plus
sqh-PB 174 CG3595-PB 32..164 12..152 142 26.2 Plus
sqh-PA 174 CG3595-PA 32..164 12..152 142 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19647-PA 155 GI19647-PA 1..155 1..155 749 94.2 Plus
Dmoj\GI12482-PA 155 GI12482-PA 1..155 1..155 739 92.9 Plus
Dmoj\GI18874-PA 186 GI18874-PA 35..183 6..154 506 66.4 Plus
Dmoj\GI24238-PA 143 GI24238-PA 3..143 15..155 414 58.9 Plus
Dmoj\GI18875-PA 220 GI18875-PA 13..156 11..153 379 52.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16748-PA 155 GL16748-PA 1..155 1..155 768 96.8 Plus
Dper\GL11919-PA 155 GL11919-PA 1..155 1..155 727 90.3 Plus
Dper\GL11049-PA 207 GL11049-PA 52..204 2..154 500 64.7 Plus
Dper\GL15651-PA 422 GL15651-PA 266..420 1..154 416 52.3 Plus
Dper\GL19565-PA 149 GL19565-PA 5..149 11..155 410 57.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\TpnCIb-PA 155 GA21520-PA 1..155 1..155 768 96.8 Plus
Dpse\TpnCIa-PA 155 GA23964-PA 1..155 1..155 727 90.3 Plus
Dpse\TpnCII-PA 149 GA19654-PA 5..149 11..155 410 57.2 Plus
Dpse\TpnCIIIb-PA 174 GA11615-PA 20..172 3..154 405 52.3 Plus
Dpse\GA24499-PA 149 GA24499-PA 5..147 8..153 286 41.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20459-PA 155 GM20459-PA 1..155 1..155 787 100 Plus
Dsec\GM25686-PA 155 GM25686-PA 1..155 1..155 741 92.9 Plus
Dsec\GM18540-PA 143 GM18540-PA 3..143 15..155 412 59.6 Plus
Dsec\GM16508-PA 155 GM16508-PA 3..153 5..154 403 51.7 Plus
Dsec\GM13554-PA 131 GM13554-PA 1..127 4..131 296 49.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\TpnC47D-PA 155 GD25928-PA 1..155 1..155 787 100 Plus
Dsim\GD14691-PA 155 GD14691-PA 1..155 1..155 741 92.9 Plus
Dsim\GD16679-PA 154 GD16679-PA 1..151 4..154 499 64.2 Plus
Dsim\GD23329-PA 149 GD23329-PA 5..149 11..155 415 58.6 Plus
Dsim\GD10357-PA 155 GD10357-PA 3..153 5..154 403 51.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TpnCIb-PA 155 GJ15012-PA 1..155 1..155 762 95.5 Plus
Dvir\TpnCIa-PA 158 GJ12386-PA 7..158 4..155 735 94.1 Plus
Dvir\TpnCIIIa-PA 158 GJ21908-PA 7..155 6..154 503 65.8 Plus
Dvir\TpnCII-PA 143 GJ21496-PA 3..143 15..155 411 58.9 Plus
Dvir\TpnCIIIb-PA 189 GJ21909-PA 8..152 11..154 377 51.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21627-PA 155 GK21627-PA 1..155 1..155 762 95.5 Plus
Dwil\GK15267-PA 155 GK15267-PA 1..155 1..155 739 92.9 Plus
Dwil\GK21371-PA 151 GK21371-PA 2..148 8..154 483 63.3 Plus
Dwil\GK21094-PA 150 GK21094-PA 6..150 11..155 415 57.9 Plus
Dwil\GK21946-PA 557 GK21946-PA 406..555 6..154 409 52.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\TpnC47D-PA 155 GE13037-PA 1..155 1..155 783 99.4 Plus
Dyak\GE19899-PA 155 GE19899-PA 1..155 1..155 741 92.9 Plus
Dyak\GE11315-PA 152 GE11315-PA 1..149 6..154 497 65.1 Plus
Dyak\GE25333-PA 143 GE25333-PA 3..143 15..155 412 59.6 Plus
Dyak\TpnC4-PA 170 GE11292-PA 21..165 11..154 396 53.1 Plus

FI01417.hyp Sequence

Translation from 60 to 527

> FI01417.hyp
MDNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQ
ILDELIDEVDEDKSGRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYD
KQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFME
MMTGE*

FI01417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC47D-PB 155 CG9073-PB 1..155 1..155 788 100 Plus
TpnC47D-PA 155 CG9073-PA 1..155 1..155 788 100 Plus
TpnC73F-PC 155 CG7930-PC 1..155 1..155 739 92.9 Plus
TpnC73F-PA 155 CG7930-PA 1..155 1..155 739 92.9 Plus
TpnC41C-PB 154 CG2981-PB 1..151 4..154 498 64.2 Plus