Clone FI01423 Report

Search the DGRC for FI01423

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:23
Vector:pFlc-1
Associated Gene/TranscriptGstE3-RA
Protein status:FI01423.pep: gold
Sequenced Size:767

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
GstE3 2008-04-29 Release 5.5 accounting
GstE3 2008-08-15 Release 5.9 accounting
GstE3 2008-12-18 5.12 accounting

Clone Sequence Records

FI01423.complete Sequence

767 bp assembled on 2007-09-05

GenBank Submission: BT030772

> FI01423.complete
AAGTAGTTACTAGTCAATCGCCTTACAGCACACTACAGACATGGGAAAAC
TTACGCTTTACGGAATCGACGGTAGTCCTCCGGTCCGTTCGGTGCTGCTC
ACGCTGAGAGCCTTGAATTTGGACTTCGACTACAAGATCGTCAATCTGAT
GGAGAAGGAGCACCTGAAGCCAGAGTTCCTCAAGATCAATCCCCTGCACA
CCGTGCCCGCTCTGGATGATAATGGTTTCTATTTGGCCGACAGCCATGCT
ATTAACTCCTACCTGGTGAGCAAGTACGGCCGGAATGATTCTCTATACCC
CAAGGATCTGAAGAAGCGAGCCATTGTCGATCAGCGTCTGCACTACGACT
CCAGCGTGGTGACCTCGACAGGAAGGGCTATCACCTTTCCGCTCTTCTGG
GAGAACAAGACGGAGATTCCACAGGCGAGGATCGATGCCCTGGAGGGTGT
TTACAAGTCCCTCAATCTGTTTCTGGAGAATGGCAATTATCTGGCCGGCG
ACAACCTGACCATTGCCGATTTCCACGTCATCGCCGGCTTGACAGGATTT
TTCGTGTTCCTGCCTGTAGATGCCACTAAGTATCCCGAGCTGGCTGCCTG
GATCAAGCGCATCAAGGAGCTGCCATACTACGAGGAAGCGAATGGCTCTC
GTGCTGCCCAAATCATCGAGTTCATCAAGAGCAAAAAGTTCACTATTGTT
TAAGGCATTTTAGTATAGACAAAAATAAATAAGAACAACAATTATCATAA
CAAAAAAAAAAAAAAAA

FI01423.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
GstE3-RA 753 GstE3-RA 1..751 1..751 3725 99.7 Plus
GstD1-RA 828 GstD1-RA 179..236 158..215 185 87.9 Plus
GstD1.a 840 GstD1.a 197..254 158..215 185 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14287762..14288512 1..751 3695 99.5 Plus
chr3R 27901430 chr3R 8193780..8193837 215..158 185 87.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:05:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18400717..18401467 1..751 3725 99.7 Plus
3R 32079331 3R 12368403..12368460 215..158 185 87.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18401916..18402666 1..751 3725 99.7 Plus
3R 31820162 3R 12109234..12109291 215..158 185 87.9 Minus
Blast to na_te.dros performed on 2019-03-15 14:54:54 has no hits.

FI01423.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:55:52 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14287762..14288512 1..751 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:30 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..663 41..703 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:55 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..663 41..703 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:49:59 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..663 41..703 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:21 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..663 41..703 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:18 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..663 41..703 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:51 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..751 1..751 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:55 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..751 1..751 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:49:59 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 5..755 1..751 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:21 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 1..751 1..751 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:18 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
GstE3-RA 5..755 1..751 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:52 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18400717..18401467 1..751 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:52 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18400717..18401467 1..751 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:52 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18400717..18401467 1..751 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:49:59 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14288222..14288972 1..751 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:43 Download gff for FI01423.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18401916..18402666 1..751 99   Plus

FI01423.hyp Sequence

Translation from 40 to 702

> FI01423.hyp
MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKIN
PLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRL
HYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNY
LAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKELPYYEEA
NGSRAAQIIEFIKSKKFTIV*

FI01423.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
GstE3-PA 220 CG17524-PA 1..220 1..220 1137 100 Plus
GstE7-PA 223 CG17531-PA 1..219 1..218 601 54.3 Plus
GstE8-PB 222 CG17533-PB 1..219 1..218 595 52.5 Plus
GstE8-PA 222 CG17533-PA 1..219 1..218 595 52.5 Plus
GstE4-PA 222 CG17525-PA 1..221 1..220 589 50.7 Plus

FI01423.pep Sequence

Translation from 40 to 702

> FI01423.pep
MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKIN
PLHTVPALDDNGFYLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRL
HYDSSVVTSTGRAITFPLFWENKTEIPQARIDALEGVYKSLNLFLENGNY
LAGDNLTIADFHVIAGLTGFFVFLPVDATKYPELAAWIKRIKELPYYEEA
NGSRAAQIIEFIKSKKFTIV*

FI01423.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12166-PA 220 GF12166-PA 1..220 1..220 929 77.3 Plus
Dana\GF12163-PA 220 GF12163-PA 1..220 1..220 917 78.6 Plus
Dana\GF12165-PA 220 GF12165-PA 1..220 1..220 868 73.6 Plus
Dana\GF12164-PA 220 GF12164-PA 1..220 1..220 820 67.7 Plus
Dana\GF12167-PA 219 GF12167-PA 1..219 1..220 799 67.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21883-PA 220 GG21883-PA 1..219 1..219 1052 90.9 Plus
Dere\GG21890-PA 222 GG21890-PA 1..219 1..218 602 53 Plus
Dere\GG21886-PA 222 GG21886-PA 1..221 1..220 599 49.8 Plus
Dere\GG21887-PA 222 GG21887-PA 1..219 1..218 585 50.7 Plus
Dere\GG21889-PA 222 GG21889-PA 1..218 1..218 583 52.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15974-PA 219 GH15974-PA 1..219 1..220 594 51.8 Plus
Dgri\GH21671-PA 221 GH21671-PA 1..216 1..215 565 47.7 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..215 1..215 549 50 Plus
Dgri\GH21669-PA 221 GH21669-PA 1..219 1..219 542 46.8 Plus
Dgri\GH13568-PA 220 GH13568-PA 1..214 1..215 500 45.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
GstE3-PA 220 CG17524-PA 1..220 1..220 1137 100 Plus
GstE7-PA 223 CG17531-PA 1..219 1..218 601 54.3 Plus
GstE8-PB 222 CG17533-PB 1..219 1..218 595 52.5 Plus
GstE8-PA 222 CG17533-PA 1..219 1..218 595 52.5 Plus
GstE4-PA 222 CG17525-PA 1..221 1..220 589 50.7 Plus
GstE6-PA 222 CG17530-PA 1..219 1..218 586 49.8 Plus
GstE5-PA 222 CG17527-PA 1..219 1..218 575 50.2 Plus
GstE1-PA 224 CG5164-PA 6..217 4..215 526 48.1 Plus
GstE9-PA 221 CG17534-PA 1..221 1..220 517 45.7 Plus
GstE10-PB 240 CG17522-PB 1..217 1..215 513 48.4 Plus
GstE10-PA 240 CG17522-PA 1..217 1..215 513 48.4 Plus
GstE2-PA 221 CG17523-PA 4..214 3..213 487 46.4 Plus
GstE12-PC 223 CG16936-PC 1..216 1..215 453 43.5 Plus
GstE12-PB 223 CG16936-PB 1..216 1..215 453 43.5 Plus
GstE12-PD 223 CG16936-PD 1..216 1..215 453 43.5 Plus
GstE12-PA 223 CG16936-PA 1..216 1..215 453 43.5 Plus
GstE11-PB 225 CG5224-PB 4..216 3..213 443 43.2 Plus
GstE11-PA 225 CG5224-PA 4..216 3..213 443 43.2 Plus
GstD1-PB 209 CG10045-PB 5..196 7..199 396 42.8 Plus
GstD1-PA 209 CG10045-PA 5..196 7..199 396 42.8 Plus
GstD5-PA 216 CG12242-PA 13..195 16..199 388 41.6 Plus
GstD8-PA 212 CG4421-PA 9..195 12..199 373 41.3 Plus
GstE13-PB 226 CG11784-PB 1..211 1..207 373 37.9 Plus
GstE13-PA 226 CG11784-PA 1..211 1..207 373 37.9 Plus
GstD3-PA 199 CG4381-PA 4..195 23..216 353 36.6 Plus
GstD2-PA 215 CG4181-PA 1..195 4..199 352 38.1 Plus
GstD4-PA 215 CG11512-PA 13..195 16..199 351 37.8 Plus
GstD11-PA 222 CG17639-PA 1..216 1..215 349 36.2 Plus
GstD7-PA 224 CG4371-PA 1..221 1..216 349 36.3 Plus
GstD11-PB 243 CG17639-PB 22..237 1..215 349 36.2 Plus
GstD10-PB 210 CG18548-PB 1..196 4..199 348 39.4 Plus
GstD10-PA 210 CG18548-PA 1..196 4..199 348 39.4 Plus
GstD9-PB 218 CG10091-PB 2..198 4..199 337 39.4 Plus
GstD9-PA 218 CG10091-PA 2..198 4..199 337 39.4 Plus
GstD6-PA 215 CG4423-PA 1..207 4..212 332 34.9 Plus
gfzf-PD 234 CG33546-PD 1..209 4..211 253 31.8 Plus
gfzf-PE 1045 CG33546-PE 812..1020 4..211 253 31.8 Plus
gfzf-PB 1045 CG33546-PB 812..1020 4..211 253 31.8 Plus
GstE14-PA 232 CG4688-PA 5..220 3..217 250 30.1 Plus
GstT3-PC 228 CG1702-PC 13..213 12..201 198 29.7 Plus
GstT3-PA 228 CG1702-PA 13..213 12..201 198 29.7 Plus
GstT3-PB 268 CG1702-PB 53..253 12..201 198 29.7 Plus
GstT2-PA 228 CG30005-PA 13..211 12..199 185 31.5 Plus
GstT1-PA 228 CG30000-PA 13..213 12..201 184 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20121-PA 222 GI20121-PA 1..220 1..219 599 51.4 Plus
Dmoj\GI20122-PA 221 GI20122-PA 1..220 1..220 597 54.3 Plus
Dmoj\GI16623-PA 219 GI16623-PA 1..219 1..220 580 51.4 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..219 1..220 568 50.9 Plus
Dmoj\GI20124-PA 221 GI20124-PA 1..221 1..220 555 47.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17770-PA 222 GL17770-PA 1..222 1..220 858 73 Plus
Dper\GL17772-PA 222 GL17772-PA 1..222 1..220 790 67.1 Plus
Dper\GL17771-PA 221 GL17771-PA 1..220 1..220 614 52.5 Plus
Dper\GL17773-PA 222 GL17773-PA 1..219 1..218 576 50.2 Plus
Dper\GL17769-PA 219 GL17769-PA 1..214 1..214 509 47.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14541-PA 222 GA14541-PA 1..222 1..220 867 73.9 Plus
Dpse\GA24907-PA 222 GA24907-PA 1..222 1..220 793 67.1 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..220 1..220 611 52 Plus
Dpse\GA14545-PA 222 GA14545-PA 1..219 1..218 577 50.7 Plus
Dpse\GA14540-PA 219 GA14540-PA 1..219 1..220 512 47.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21876-PA 220 GM21876-PA 1..220 1..220 1102 95 Plus
Dsec\GM21882-PA 222 GM21882-PA 1..219 1..218 599 52.1 Plus
Dsec\GM21879-PA 222 GM21879-PA 1..221 1..220 596 49.8 Plus
Dsec\GM21880-PA 222 GM21880-PA 1..219 1..218 586 50.7 Plus
Dsec\GM23093-PA 119 GM23093-PA 1..119 102..220 573 91.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11371-PA 219 GD11371-PA 1..219 1..220 843 72.3 Plus
Dsim\GD11377-PA 222 GD11377-PA 1..219 1..218 599 51.6 Plus
Dsim\GD11373-PA 222 GD11373-PA 1..221 1..220 594 49.8 Plus
Dsim\GD11376-PA 223 GD11376-PA 1..219 1..218 592 53 Plus
Dsim\GD11374-PA 222 GD11374-PA 1..219 1..218 588 51.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19893-PA 221 GJ19893-PA 1..220 1..220 594 52.9 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..221 1..220 593 51.6 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..219 1..220 571 51.4 Plus
Dvir\GJ19892-PA 219 GJ19892-PA 1..218 1..220 567 50.7 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 1..221 1..220 560 44.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22984-PA 220 GK22984-PA 1..220 1..220 798 69.1 Plus
Dwil\GK22988-PA 220 GK22988-PA 1..219 1..219 702 60.3 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..221 1..220 628 54.3 Plus
Dwil\GK22991-PA 222 GK22991-PA 1..220 1..219 598 51.8 Plus
Dwil\GK22985-PA 219 GK22985-PA 1..213 1..213 571 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GstE3-PA 220 GE11958-PA 1..220 1..220 1088 92.7 Plus
Dyak\GE11959-PA 206 GE11959-PA 1..206 1..220 703 63.2 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..218 1..218 608 53.9 Plus
Dyak\GE11962-PA 222 GE11962-PA 1..219 1..218 607 52.5 Plus
Dyak\GE11965-PA 222 GE11965-PA 1..219 1..218 607 53 Plus