Clone FI01426 Report

Search the DGRC for FI01426

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:26
Vector:pFlc-1
Associated Gene/TranscriptHP4-RA
Protein status:FI01426.pep: gold
Sequenced Size:655

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8044 2008-04-29 Release 5.5 accounting
CG8044 2008-08-15 Release 5.9 accounting
Hip 2008-12-18 5.12 accounting

Clone Sequence Records

FI01426.complete Sequence

655 bp assembled on 2007-09-04

GenBank Submission: BT030775

> FI01426.complete
AGTTCGAGGTTGCCTGCGACGTTTACCAACTCTGCAAATTTGGCGTCTAC
GGAGATAGGTTTTTTCGACTTTGAAAGAGAAATTTCAACAATTTTATAAT
CAAAACCATGTCACCGAAGACTAAAAAAATGATCGTCAAGATTCCGCGCC
ATCCCTACTTCAATGTGCAGGGCGAACGGAGCGTGGAGCGCGAGGTGGAG
TACCAGGTCCGAAAGTGTCGCGTGAATCTGGAGCGCATCAAGTCGTCGAC
TTCTCCGAATTCCCGTCCATTCCCGTTAAAACCGAAGCCCAAGAGATGCA
TTGTACGTGTAGCCCGACTGCCGGACGTGGAGCGCAGCGAGATTTCCGTG
ACACCGGCCAGTTCCATCATGAATTCCGACATTGACGAGAATAGTGGCAG
CGATCAGGAGTCTAATCTGACAATCTAGTCGTCTCATACTCAAAGAGCAA
TCAACGCATCCAGCTGACAAACTTCTAATCGCACTTGGAGTCATTCGAAG
TACACAGAGTACATGTCCAAGATAAACCAAATAGATGTGCGGGGCTATCC
TTTTCCTGAATATATATGTATAAGATCCTTATCTAAGACTTTATGCAAAT
CAAGCTCGATTTCTTAATACAAACTCGTGCGCCTAAATAGAAAAAAAAAA
AAAAA

FI01426.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
HP4-RA 888 HP4-RA 58..699 1..642 3210 100 Plus
HP4-RB 720 HP4-RB 7..400 1..394 1955 99.7 Plus
HP4-RB 720 HP4-RB 471..720 391..640 1250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7967916..7968309 394..1 1955 99.7 Minus
chr3L 24539361 chr3L 7967596..7967845 640..391 1250 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7975758..7976151 394..1 1955 99.7 Minus
3L 28110227 3L 7975436..7975687 642..391 1260 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7968858..7969251 394..1 1955 99.7 Minus
3L 28103327 3L 7968536..7968787 642..391 1260 100 Minus
Blast to na_te.dros performed 2019-03-15 23:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2027..2103 171..95 115 61 Minus

FI01426.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:36:58 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7967596..7967845 391..640 100 <- Minus
chr3L 7967920..7968309 1..390 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:37 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
Hip-RA 1..321 108..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:31 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 1..321 108..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:43:32 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 1..321 108..428 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:42:56 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
CG8044-RA 1..321 108..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:41:23 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 1..321 108..428 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:33 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
Hip-RA 1..640 1..640 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:31 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 7..646 1..640 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:43:32 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 4..643 1..640 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:42:57 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
CG8044-RA 1..640 1..640 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:41:23 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 4..643 1..640 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:36:58 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7975438..7975687 391..640 100 <- Minus
3L 7975762..7976151 1..390 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:36:58 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7975438..7975687 391..640 100 <- Minus
3L 7975762..7976151 1..390 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:36:58 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7975438..7975687 391..640 100 <- Minus
3L 7975762..7976151 1..390 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:32 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7968538..7968787 391..640 100 <- Minus
arm_3L 7968862..7969251 1..390 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:17 Download gff for FI01426.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7968538..7968787 391..640 100 <- Minus
3L 7968862..7969251 1..390 100   Minus

FI01426.pep Sequence

Translation from 107 to 427

> FI01426.pep
MSPKTKKMIVKIPRHPYFNVQGERSVEREVEYQVRKCRVNLERIKSSTSP
NSRPFPLKPKPKRCIVRVARLPDVERSEISVTPASSIMNSDIDENSGSDQ
ESNLTI*

FI01426.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10631-PA 107 GF10631-PA 14..107 12..99 320 73.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14928-PA 106 GG14928-PA 1..106 1..106 486 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16506-PA 123 GH16506-PA 15..100 13..95 224 53.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
HP4-PA 106 CG8044-PA 1..106 1..106 541 100 Plus
HP4-PB 100 CG8044-PB 1..95 1..95 483 98.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12184-PA 100 GI12184-PA 1..97 1..95 280 64.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17816-PA 85 GL17816-PA 4..78 3..79 242 63.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28494-PA 85 GA28494-PA 4..78 3..79 243 63.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24978-PA 107 GM24978-PA 1..107 1..106 465 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13027-PA 107 GD13027-PA 1..107 1..106 465 93.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11420-PA 107 GJ11420-PA 1..95 1..95 318 67 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20312-PA 105 GK20312-PA 2..86 6..98 218 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20380-PA 106 GE20380-PA 1..106 1..106 502 92.5 Plus

FI01426.hyp Sequence

Translation from 107 to 427

> FI01426.hyp
MSPKTKKMIVKIPRHPYFNVQGERSVEREVEYQVRKCRVNLERIKSSTSP
NSRPFPLKPKPKRCIVRVARLPDVERSEISVTPASSIMNSDIDENSGSDQ
ESNLTI*

FI01426.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
HP4-PA 106 CG8044-PA 1..106 1..106 541 100 Plus
HP4-PB 100 CG8044-PB 1..95 1..95 483 98.9 Plus