Clone FI01427 Report

Search the DGRC for FI01427

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:27
Vector:pFlc-1
Associated Gene/TranscriptCG14500-RA
Protein status:FI01427.pep: gold
Sequenced Size:692

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14500 2008-04-29 Release 5.5 accounting
CG14500 2008-08-15 Release 5.9 accounting
CG14500 2008-12-18 5.12 accounting

Clone Sequence Records

FI01427.complete Sequence

692 bp assembled on 2007-09-04

GenBank Submission: BT030776

> FI01427.complete
TGTTACCCACTATGTTATCGACCAAGTTAGTTTGCATCGCACTGGTCAGC
CTGGCTTTTGGCCAAGTTTATCTGGTGGCCAGCGAGGAAACCATTACCCT
TTGTCCCACCAACTTTACCCAGGTGGCGGATAAGTGTCTCCTGGTGGATG
GCAGTTGGAAGAACTTCTACGAGTCGGATCGCCATTGTCGATCCCTTAAC
GCCGGACTTCTGAGCATTAGCAATCCAACGGAATTCAATGTCATCAACGA
ATGGCTGCCGATCATTGCACCATACCAGCCGGAGTTCTGGACATCCGGAA
ACAAGCTGGGCGGAACTTCCGATTACTACTGGCAGAGTACTGGGCAGAAG
GCTGTCTACCTTCCCTGGAGTGCTGGTCAACCCACTACCACCGCCGGTGA
TTGTCTTACACTGATGGCCAACGTCACCATGACTCCCGAAGAAGCCATAT
TGAGTGTGCACCGCCTAACGGTAAAGCCCTGCACCCAATGGGCACCCCAC
ATCTGCCAGGCTCCACTGGAAATCTTCAAGACCCAGCTTTGTCTCAATAC
CACAGCTTTCTTCGAGGCGAAGATACCCGTTTAAGTAAATTCAGGGGGCC
ATAATTGTTCGTTTTTCAATAATTATAAATTGTCATAACTAAAAACTACG
TTTTAAATAAACTTGAGCAACTTTTGAAAAAAAAAAAAAAAA

FI01427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14500-RA 676 CG14500-RA 2..676 2..676 3375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14076120..14076794 2..676 3285 99.1 Plus
chr2R 21145070 chr2R 14074847..14075443 2..598 1380 82.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 16:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
CR14499-RA 568 CR14499-RA 272..567 288..583 775 84.1 Plus
CR14499-RA 568 CR14499-RA 1..241 12..257 590 83.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18188980..18189657 2..679 3390 100 Plus
2R 25286936 2R 18187712..18188303 2..598 1300 81.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18190179..18190856 2..679 3390 100 Plus
2R 25260384 2R 18189192..18189502 288..598 790 83.6 Plus
2R 25260384 2R 18188911..18189161 2..257 595 82.8 Plus
Blast to na_te.dros performed on 2019-03-16 20:26:19 has no hits.

FI01427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:27:27 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14076119..14076794 1..676 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:39 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 1..573 12..584 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:32 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 1..573 12..584 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:07:32 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 1..573 12..584 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:42:58 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 1..573 12..584 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:44 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 1..573 12..584 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:02 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:38 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 2..676 2..676 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:32 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 2..676 2..676 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:07:32 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 2..677 1..676 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:42:58 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 2..676 2..676 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:44 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
CG14500-RA 2..677 1..676 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:27 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18188979..18189654 1..676 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:27 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18188979..18189654 1..676 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:27 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18188979..18189654 1..676 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:07:32 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14076484..14077159 1..676 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:18 Download gff for FI01427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18190178..18190853 1..676 99   Plus

FI01427.hyp Sequence

Translation from 2 to 583

> FI01427.hyp
LPTMLSTKLVCIALVSLAFGQVYLVASEETITLCPTNFTQVADKCLLVDG
SWKNFYESDRHCRSLNAGLLSISNPTEFNVINEWLPIIAPYQPEFWTSGN
KLGGTSDYYWQSTGQKAVYLPWSAGQPTTTAGDCLTLMANVTMTPEEAIL
SVHRLTVKPCTQWAPHICQAPLEIFKTQLCLNTTAFFEAKIPV*

FI01427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14500-PA 190 CG14500-PA 1..190 4..193 1023 100 Plus
CG14499-PB 188 CG14499-PB 1..187 4..192 784 75.1 Plus

FI01427.pep Sequence

Translation from 11 to 583

> FI01427.pep
MLSTKLVCIALVSLAFGQVYLVASEETITLCPTNFTQVADKCLLVDGSWK
NFYESDRHCRSLNAGLLSISNPTEFNVINEWLPIIAPYQPEFWTSGNKLG
GTSDYYWQSTGQKAVYLPWSAGQPTTTAGDCLTLMANVTMTPEEAILSVH
RLTVKPCTQWAPHICQAPLEIFKTQLCLNTTAFFEAKIPV*

FI01427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12101-PA 193 GF12101-PA 1..193 1..190 666 65.3 Plus
Dana\GF12102-PA 193 GF12102-PA 1..193 1..190 646 62.7 Plus
Dana\GF12144-PA 197 GF12144-PA 1..195 1..190 593 57.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21856-PA 190 GG21856-PA 1..190 1..190 940 91.6 Plus
Dere\GG21855-PA 190 GG21855-PA 1..190 1..190 842 79.5 Plus
Dere\GG12225-PA 134 GG12225-PA 2..129 34..167 147 28.7 Plus
Dere\GG21174-PA 186 GG21174-PA 43..175 35..168 146 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19783-PA 189 GH19783-PA 4..186 4..188 379 40.3 Plus
Dgri\GH25233-PA 189 GH25233-PA 5..186 5..188 372 40 Plus
Dgri\GH19784-PA 189 GH19784-PA 1..164 1..166 356 40.1 Plus
Dgri\GH25235-PA 189 GH25235-PA 5..164 5..166 350 39.9 Plus
Dgri\GH19780-PA 186 GH19780-PA 1..183 1..188 318 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14500-PA 190 CG14500-PA 1..190 1..190 1023 100 Plus
CG14499-PC 188 CG14499-PC 1..187 1..189 779 74.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20318-PA 189 GI20318-PA 1..186 1..188 395 41.1 Plus
Dmoj\GI20320-PA 189 GI20320-PA 1..186 1..188 392 40.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16715-PA 192 GL16715-PA 1..192 1..190 559 54.2 Plus
Dper\GL26627-PA 180 GL26627-PA 4..180 1..188 139 23.7 Plus
Dper\GL26241-PA 180 GL26241-PA 58..170 50..168 138 27.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13034-PA 192 GA13034-PA 1..192 1..190 563 54.7 Plus
Dpse\GA28093-PA 180 GA28093-PA 58..170 50..168 138 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21855-PA 340 GM21855-PA 1..188 1..188 873 84.6 Plus
Dsec\GM21855-PA 340 GM21855-PA 187..340 37..190 803 94.8 Plus
Dsec\GM17341-PA 186 GM17341-PA 43..175 35..168 149 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11350-PA 190 GD11350-PA 1..190 1..190 977 95.3 Plus
Dsim\GD11349-PA 190 GD11349-PA 1..189 1..189 884 84.7 Plus
Dsim\GD11348-PA 190 GD11348-PA 1..189 1..189 763 72 Plus
Dsim\Lectin-galC1-PA 186 GD24200-PA 43..175 35..168 157 28.3 Plus
Dsim\GD24201-PA 186 GD24201-PA 35..177 27..170 137 28 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22044-PA 186 GJ22044-PA 1..186 1..190 399 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19392-PA 190 GK19392-PA 1..190 1..190 569 53.2 Plus
Dwil\GK23834-PA 184 GK23834-PA 12..175 6..170 150 25.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11936-PA 190 GE11936-PA 1..190 1..190 932 89.5 Plus
Dyak\GE11935-PA 190 GE11935-PA 1..190 1..190 816 77.9 Plus
Dyak\GE11934-PA 190 GE11934-PA 1..189 1..189 704 68.8 Plus