Clone FI01445 Report

Search the DGRC for FI01445

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:45
Vector:pFlc-1
Associated Gene/TranscriptthetaTry-RA
Protein status:FI01445.pep: gold
Sequenced Size:1058

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
thetaTry 2008-04-29 Release 5.5 accounting
thetaTry 2008-08-15 Release 5.9 accounting
thetaTry 2008-12-18 5.12 accounting

Clone Sequence Records

FI01445.complete Sequence

1058 bp assembled on 2007-09-05

GenBank Submission: BT030780

> FI01445.complete
AGTTTTTTTCCAGAATGCACAGATTAGTGGTTCTTTTAGTTTGCCTGGCT
GTGGGTTCCGCCTGTGCTGGCACAGTCGGGGTCTCCAATGGTGATCCCTT
CGAGCGCGAAGGTCGCATTGTCGGCGGCGAGGATACAACAATCGGAGCGC
ATCCCTACCAGGTTTCCCTGCAGACCAAGAGTGGCTCCCACTTCTGTGGT
GGTAGTTTGATCAACGAAGATACTGTTGTCACGGCGGCCCACTGTCTGGT
GGGAAGGAAGGTCTCCAAGGTGTTCGTGCGTCTCGGTTCCACGCTCTACA
ATGAGGGTGGAATTGTGGTTGCTGTCCGGGAGTTGGCATACAATGAGGAC
TATAACTCGAAGACCATGGAGTACGACGTGGGCATACTGAAGCTGGACGA
GAAGGTAAAGGAAACCGAAAATATTCGATATATCGAACTGGCCACGGAAA
CGCCGCCCACTGGCACCACCGCTGTGGTCACCGGCTGGGGTTCCAAGTGC
TACTTCTGGTGCATGACACTGCCCAAGACGCTCCAGGAGGTCTATGTCAA
CATTGTGGACTGGAAGACGTGCGCTTCGGATGAGTACAAGTACGGAGAGA
TCATCTACGATAGCATGGTGTGTGCCTATGAAAAGAAGAAGGACGCTTGC
CAAGGAGATTCCGGTGGTCCTCTGGCGGTCGGTAACACTCTGGTGGGAAT
CGTGTCCTGGGGATATGCCTGTGCCTCGAACCTACTGCCCGGTGTTTACT
CCGATGTGCCCGCTTTGCGAAAGTGGATCCTGAATGCAAGCGAAACTTTG
TAGATATAAATAATAATAATATACTAGACCGGCATACTAGACTGGCATAC
TTTCGGGGATTATATAGCGATTCGAAATCAAAAAGCTTCCCATCTGCCCA
TCTAATTGTTAATAAGTTTCATATGGATGATACAATTATGATTTATGGCA
AATTTCGATGTTGCTTTCTCAAGTCTTTTAGCCAATCTATGGTGTCTCAG
AAAAATTAGTATTGACTAAATTGTAAATATATATTAAACAGCCAAAAAAA
AAAAAAAA

FI01445.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
thetaTry-RA 1043 thetaTry-RA 1..1043 1..1043 5200 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7229169..7230211 1043..1 5155 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11341709..11342756 1048..1 5225 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11342908..11343955 1048..1 5225 99.9 Minus
Blast to na_te.dros performed on 2019-03-16 06:09:17 has no hits.

FI01445.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:10:00 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7229169..7230211 1..1043 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:54 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..789 15..803 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:00 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..789 15..803 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:34 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..789 15..803 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:26 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..789 15..803 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:41 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..789 15..803 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:39:04 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..1043 1..1043 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:00 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..1043 1..1043 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:34 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 5..1047 1..1043 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:26 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 1..1043 1..1043 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:41 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
thetaTry-RA 5..1047 1..1043 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:00 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11341714..11342756 1..1043 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:00 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11341714..11342756 1..1043 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:00 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11341714..11342756 1..1043 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:34 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7229219..7230261 1..1043 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:50 Download gff for FI01445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11342913..11343955 1..1043 99   Minus

FI01445.hyp Sequence

Translation from 2 to 802

> FI01445.hyp
CFSRMHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAH
PYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYN
EGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATET
PPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEI
IYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYS
DVPALRKWILNASETL*

FI01445.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
thetaTry-PA 262 CG12385-PA 1..262 5..266 1390 100 Plus
CG17571-PB 258 CG17571-PB 1..258 5..266 666 51.9 Plus
CG17571-PA 258 CG17571-PA 1..258 5..266 666 51.9 Plus
epsilonTry-PA 256 CG18681-PA 1..254 5..264 579 47.3 Plus
alphaTry-PA 256 CG18444-PA 2..256 8..266 567 44.8 Plus

FI01445.pep Sequence

Translation from 14 to 802

> FI01445.pep
MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQV
SLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGI
VVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTG
TTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDS
MVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPA
LRKWILNASETL*

FI01445.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12404-PA 262 GF12404-PA 1..262 1..262 1109 79.8 Plus
Dana\GF15448-PA 257 GF15448-PA 27..257 28..262 684 54.5 Plus
Dana\GF12402-PA 256 GF12402-PA 1..249 1..255 590 48.2 Plus
Dana\GF12546-PA 256 GF12546-PA 1..256 1..262 512 43.5 Plus
Dana\GF12403-PA 256 GF12403-PA 1..256 1..262 509 43.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\thetaTry-PA 262 GG22662-PA 1..262 1..262 1221 91.2 Plus
Dere\GG21582-PA 258 GG21582-PA 1..258 1..262 638 50 Plus
Dere\epsilonTry-PA 256 GG22660-PA 1..249 1..255 571 47.1 Plus
Dere\alphaTry-PA 256 GG22661-PA 1..256 1..262 513 45.4 Plus
Dere\deltaTry-PA 253 GG20195-PA 1..250 1..256 507 44.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10777-PA 258 GH10777-PA 1..258 1..262 610 48.5 Plus
Dgri\GH22866-PA 255 GH22866-PA 5..255 6..262 566 45.5 Plus
Dgri\GH22926-PA 256 GH22926-PA 1..256 1..262 562 44.3 Plus
Dgri\GH22924-PA 256 GH22924-PA 1..256 1..262 559 44.3 Plus
Dgri\GH22925-PA 254 GH22925-PA 1..254 1..260 536 43.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
thetaTry-PA 262 CG12385-PA 1..262 1..262 1390 100 Plus
CG17571-PB 258 CG17571-PB 1..258 1..262 666 51.9 Plus
CG17571-PA 258 CG17571-PA 1..258 1..262 666 51.9 Plus
epsilonTry-PA 256 CG18681-PA 1..254 1..260 579 47.3 Plus
alphaTry-PA 256 CG18444-PA 2..256 4..262 567 44.8 Plus
CG30025-PA 253 CG30025-PA 1..251 1..257 564 46.3 Plus
gammaTry-PA 253 CG30028-PA 1..251 1..257 559 45.9 Plus
deltaTry-PA 253 CG12351-PA 1..251 1..257 559 45.9 Plus
CG30031-PA 253 CG30031-PA 1..251 1..257 559 45.9 Plus
betaTry-PB 253 CG18211-PB 2..251 4..257 557 44.9 Plus
betaTry-PA 253 CG18211-PA 2..251 4..257 557 44.9 Plus
Ser8-PA 260 CG4812-PA 33..260 33..262 478 44.6 Plus
iotaTry-PA 252 CG7754-PA 23..252 30..262 465 41 Plus
CG17239-PB 248 CG17239-PB 23..244 34..262 401 40.2 Plus
CG17239-PA 248 CG17239-PA 23..244 34..262 401 40.2 Plus
lambdaTry-PA 272 CG12350-PA 1..257 1..256 398 36.9 Plus
CG31954-PA 277 CG31954-PA 48..271 32..255 386 38.9 Plus
CG32269-PB 332 CG32269-PB 106..327 32..257 385 41 Plus
CG32269-PA 332 CG32269-PA 106..327 32..257 385 41 Plus
CG7829-PA 253 CG7829-PA 27..253 34..260 383 41.3 Plus
Try29F-PD 267 CG9564-PD 39..265 32..259 382 40.1 Plus
Try29F-PC 267 CG9564-PC 39..265 32..259 382 40.1 Plus
Ser12-PA 245 CG17240-PA 23..245 34..262 379 39.1 Plus
CG11192-PB 279 CG11192-PB 14..259 21..255 378 39 Plus
CG8299-PA 260 CG8299-PA 28..257 35..260 377 38.9 Plus
zetaTry-PA 280 CG12387-PA 36..273 32..255 371 40 Plus
etaTry-PA 262 CG12386-PA 23..254 30..255 369 39.4 Plus
Send1-PA 255 CG17012-PA 25..246 30..262 366 37.4 Plus
CG13430-PB 267 CG13430-PB 8..266 11..262 359 35.9 Plus
CG13430-PA 267 CG13430-PA 8..266 11..262 359 35.9 Plus
CG31681-PA 264 CG31681-PA 4..249 3..255 350 35.4 Plus
CG31269-PB 273 CG31269-PB 4..257 5..257 349 34.1 Plus
Send2-PA 239 CG18125-PA 7..232 8..262 347 36.1 Plus
CG10405-PB 268 CG10405-PB 30..262 28..255 335 34.7 Plus
CG32271-PA 248 CG32271-PA 20..242 30..255 334 37.4 Plus
CG17477-PA 267 CG17477-PA 27..247 35..255 334 35.7 Plus
CG16749-PA 265 CG16749-PA 7..257 9..255 330 36.3 Plus
CG17475-PB 288 CG17475-PB 10..267 4..255 329 32.2 Plus
CG17475-PA 288 CG17475-PA 10..267 4..255 329 32.2 Plus
CG8172-PD 371 CG8172-PD 115..362 24..255 327 36.6 Plus
CG8172-PE 545 CG8172-PE 291..536 26..255 326 36.5 Plus
CG8172-PF 561 CG8172-PF 307..552 26..255 326 36.5 Plus
CG32270-PA 259 CG32270-PA 27..251 31..255 324 38.4 Plus
CG17234-PA 251 CG17234-PA 15..246 23..258 321 36.1 Plus
CG11037-PA 292 CG11037-PA 55..288 28..262 319 35.8 Plus
CG9676-PA 251 CG9676-PA 25..245 32..255 318 36 Plus
CG34458-PA 257 CG34458-PA 29..251 32..255 318 34.5 Plus
CG31265-PA 266 CG31265-PA 30..254 28..255 318 34.1 Plus
CG33160-PA 258 CG33160-PA 26..255 27..260 317 36.2 Plus
CG3650-PA 249 CG3650-PA 15..246 21..258 313 33.6 Plus
kappaTry-PC 263 CG12388-PC 1..253 4..255 313 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21245-PA 261 GI21245-PA 1..261 1..262 990 71.4 Plus
Dmoj\GI17438-PA 258 GI17438-PA 1..258 1..262 666 52.8 Plus
Dmoj\GI17437-PA 238 GI17437-PA 7..238 28..262 652 54.7 Plus
Dmoj\GI21243-PA 255 GI21243-PA 5..255 6..262 582 47.5 Plus
Dmoj\GI18413-PA 256 GI18413-PA 1..256 1..262 515 44.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17340-PA 261 GL17340-PA 1..261 1..262 1106 79.8 Plus
Dper\GL26041-PA 259 GL26041-PA 1..259 1..262 657 51.9 Plus
Dper\GL17339-PA 256 GL17339-PA 1..256 1..262 587 47.3 Plus
Dper\GL17338-PA 256 GL17338-PA 1..256 1..262 573 45.8 Plus
Dper\GL17143-PA 256 GL17143-PA 1..256 1..262 548 47.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11597-PA 261 GA11597-PA 1..261 1..262 1106 79.8 Plus
Dpse\GA23343-PA 259 GA23343-PA 1..259 1..262 651 51.5 Plus
Dpse\GA15051-PA 256 GA15051-PA 1..256 1..262 588 46.6 Plus
Dpse\GA14937-PA 256 GA14937-PA 1..256 1..262 587 47.3 Plus
Dpse\GA24979-PA 256 GA24979-PA 1..256 1..262 548 46.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20442-PA 426 GM20442-PA 14..183 57..242 795 83.3 Plus
Dsec\GM20441-PA 256 GM20441-PA 1..256 1..262 509 45.4 Plus
Dsec\GM21468-PA 260 GM21468-PA 34..260 34..262 478 42.7 Plus
Dsec\GM21283-PA 266 GM21283-PA 2..266 4..262 448 39.9 Plus
Dsec\GM23335-PA 200 GM23335-PA 18..182 26..194 445 53.3 Plus
Dsec\GM20442-PA 426 GM20442-PA 174..418 14..255 358 38.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25908-PA 262 GD25908-PA 1..262 1..262 1279 96.2 Plus
Dsim\GD21711-PA 258 GD21711-PA 1..258 1..262 670 51.9 Plus
Dsim\GD25907-PA 485 GD25907-PA 1..230 1..236 534 47.5 Plus
Dsim\GD15391-PA 253 GD15391-PA 1..251 1..257 526 47.1 Plus
Dsim\GD15412-PA 260 GD15412-PA 34..260 34..262 490 44 Plus
Dsim\GD25907-PA 485 GD25907-PA 233..485 6..262 482 44 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20850-PA 261 GJ20850-PA 1..261 1..262 979 71 Plus
Dvir\GJ18385-PA 258 GJ18385-PA 1..251 1..255 724 57.2 Plus
Dvir\GJ21498-PA 256 GJ21498-PA 1..250 1..256 553 45.7 Plus
Dvir\GJ21497-PA 309 GJ21497-PA 81..309 32..262 546 48.9 Plus
Dvir\GJ21048-PA 259 GJ21048-PA 6..259 4..262 532 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19331-PA 263 GK19331-PA 27..262 27..262 929 71.6 Plus
Dwil\GK24137-PA 259 GK24137-PA 1..257 1..262 703 53.6 Plus
Dwil\GK24139-PA 259 GK24139-PA 1..256 1..262 654 50.4 Plus
Dwil\GK21994-PA 256 GK21994-PA 1..256 1..262 576 46.2 Plus
Dwil\GK21995-PA 256 GK21995-PA 1..256 1..262 562 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13536-PA 262 GE13536-PA 14..262 14..262 1224 92.8 Plus
Dyak\GE12601-PA 258 GE12601-PA 18..258 17..262 623 51.8 Plus
Dyak\epsilonTry-PA 256 GE13534-PA 1..256 1..262 589 47.3 Plus
Dyak\GE13533-PA 256 GE13533-PA 1..256 1..262 559 46.9 Plus
Dyak\GE12354-PA 256 GE12354-PA 1..256 1..262 559 46.9 Plus