BDGP Sequence Production Resources |
Search the DGRC for FI01448
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 14 |
Well: | 48 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG18107-RA |
Protein status: | FI01448.pep: gold |
Sequenced Size: | 298 |
Gene | Date | Evidence |
---|---|---|
CG18107 | 2008-04-29 | Release 5.5 accounting |
CG18107 | 2008-08-15 | Release 5.9 accounting |
CG18107 | 2008-12-18 | 5.12 accounting |
298 bp assembled on 2007-09-04
GenBank Submission: BT030782
> FI01448.complete GATCAGTTGTAGTTGATCGTTTGTCCGGTGTGTTCAGCTTATAAAACCGG ATCTATTAATTGAAAATCAATATGCGATTCTTTGCAATCGTCACTGTCTT TGTGCTTGGTCTTCTGGCTTTGGCCAATGCTATTCCGTTGTCACCCGATC CAGGAAATGTTATCATCAATGGCGACTGTGTGAATTGCAATGTTCGTGGT GGCAAATAGAAATTTTTAATCAAAACTTATATTTAGCATCATAATAAAAA TGTAATAAAATGAAAGCTATATTGTAAATTGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1086..1160 | 277..205 | 108 | 69.2 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14271612..14271741 | 1..129 | 96 | -> | Plus |
chr2R | 14271806..14271957 | 130..282 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..282 | 1..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..282 | 1..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..280 | 2..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..282 | 1..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18107-RA | 1..280 | 2..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18384565..18384694 | 1..129 | 99 | -> | Plus |
2R | 18384759..18384910 | 130..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18384565..18384694 | 1..129 | 99 | -> | Plus |
2R | 18384759..18384910 | 130..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18384565..18384694 | 1..129 | 99 | -> | Plus |
2R | 18384759..18384910 | 130..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14272070..14272199 | 1..129 | 99 | -> | Plus |
arm_2R | 14272264..14272415 | 130..282 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18385764..18385893 | 1..129 | 99 | -> | Plus |
2R | 18385958..18386109 | 130..282 | 99 | Plus |
Translation from 71 to 208
> FI01448.pep MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12155-PA | 45 | GF12155-PA | 1..45 | 1..45 | 198 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21875-PA | 45 | GG21875-PA | 1..45 | 1..45 | 198 | 84.4 | Plus |
Dere\GG21874-PA | 45 | GG21874-PA | 1..45 | 1..45 | 193 | 82.2 | Plus |
Dere\GG21876-PA | 45 | GG21876-PA | 1..45 | 1..45 | 187 | 75.6 | Plus |
Dere\GG21877-PA | 39 | GG21877-PA | 1..39 | 1..43 | 121 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 234 | 100 | Plus |
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 202 | 80 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 202 | 82.2 | Plus |
IM3-PB | 39 | CG16844-PB | 1..38 | 1..42 | 127 | 69 | Plus |
IM3-PA | 39 | CG16844-PA | 1..38 | 1..42 | 127 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20115-PA | 45 | GI20115-PA | 1..45 | 1..45 | 197 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17764-PA | 45 | GL17764-PA | 1..45 | 1..45 | 197 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14796-PA | 45 | GA14796-PA | 1..45 | 1..45 | 197 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21867-PA | 45 | GM21867-PA | 1..45 | 1..45 | 215 | 93.3 | Plus |
Dsec\GM21866-PA | 45 | GM21866-PA | 1..45 | 1..45 | 192 | 82.2 | Plus |
Dsec\GM21868-PA | 45 | GM21868-PA | 1..45 | 1..45 | 146 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11364-PA | 45 | GD11364-PA | 1..45 | 1..45 | 214 | 91.1 | Plus |
Dsim\GD11365-PA | 45 | GD11365-PA | 1..45 | 1..45 | 197 | 82.2 | Plus |
Dsim\GD11363-PA | 45 | GD11363-PA | 1..45 | 1..45 | 191 | 82.2 | Plus |
Dsim\GD11366-PA | 39 | GD11366-PA | 1..39 | 1..43 | 122 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19885-PA | 45 | GJ19885-PA | 1..45 | 1..45 | 193 | 80 | Plus |
Translation from 71 to 208
> FI01448.hyp MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 234 | 100 | Plus |
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 202 | 80 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 202 | 82.2 | Plus |
IM3-PB | 39 | CG16844-PB | 1..38 | 1..42 | 127 | 69 | Plus |
IM3-PA | 39 | CG16844-PA | 1..38 | 1..42 | 127 | 69 | Plus |