Clone FI01448 Report

Search the DGRC for FI01448

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG18107-RA
Protein status:FI01448.pep: gold
Sequenced Size:298

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18107 2008-04-29 Release 5.5 accounting
CG18107 2008-08-15 Release 5.9 accounting
CG18107 2008-12-18 5.12 accounting

Clone Sequence Records

FI01448.complete Sequence

298 bp assembled on 2007-09-04

GenBank Submission: BT030782

> FI01448.complete
GATCAGTTGTAGTTGATCGTTTGTCCGGTGTGTTCAGCTTATAAAACCGG
ATCTATTAATTGAAAATCAATATGCGATTCTTTGCAATCGTCACTGTCTT
TGTGCTTGGTCTTCTGGCTTTGGCCAATGCTATTCCGTTGTCACCCGATC
CAGGAAATGTTATCATCAATGGCGACTGTGTGAATTGCAATGTTCGTGGT
GGCAAATAGAAATTTTTAATCAAAACTTATATTTAGCATCATAATAAAAA
TGTAATAAAATGAAAGCTATATTGTAAATTGCAAAAAAAAAAAAAAAA

FI01448.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-RA 283 CG18107-RA 3..282 2..281 1400 100 Plus
CG15067-RA 871 CG15067-RA 785..871 281..195 435 100 Minus
IM1-RA 524 IM1-RA 185..336 65..216 340 81.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14271805..14271957 129..281 690 96.7 Plus
chr2R 21145070 chr2R 14271614..14271741 2..129 595 97.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18384758..18384910 129..281 765 100 Plus
2R 25286936 2R 18384567..18384694 2..129 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18385957..18386109 129..281 765 100 Plus
2R 25260384 2R 18385766..18385893 2..129 640 100 Plus
Blast to na_te.dros performed 2019-03-16 06:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1086..1160 277..205 108 69.2 Minus

FI01448.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:06:11 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14271612..14271741 1..129 96 -> Plus
chr2R 14271806..14271957 130..282 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:37:56 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:34 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:27 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:42:59 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:53 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:41 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..282 1..282 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:33 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..282 1..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:27 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..280 2..282 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:42:59 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..282 1..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:53 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
CG18107-RA 1..280 2..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:11 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384565..18384694 1..129 99 -> Plus
2R 18384759..18384910 130..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:11 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384565..18384694 1..129 99 -> Plus
2R 18384759..18384910 130..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:06:11 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18384565..18384694 1..129 99 -> Plus
2R 18384759..18384910 130..282 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:27 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14272070..14272199 1..129 99 -> Plus
arm_2R 14272264..14272415 130..282 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:19 Download gff for FI01448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18385764..18385893 1..129 99 -> Plus
2R 18385958..18386109 130..282 99   Plus

FI01448.pep Sequence

Translation from 71 to 208

> FI01448.pep
MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*

FI01448.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12155-PA 45 GF12155-PA 1..45 1..45 198 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21875-PA 45 GG21875-PA 1..45 1..45 198 84.4 Plus
Dere\GG21874-PA 45 GG21874-PA 1..45 1..45 193 82.2 Plus
Dere\GG21876-PA 45 GG21876-PA 1..45 1..45 187 75.6 Plus
Dere\GG21877-PA 39 GG21877-PA 1..39 1..43 121 67.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-PA 45 CG18107-PA 1..45 1..45 234 100 Plus
IM2-PA 45 CG18106-PA 1..45 1..45 202 80 Plus
IM1-PA 45 CG18108-PA 1..45 1..45 202 82.2 Plus
IM3-PB 39 CG16844-PB 1..38 1..42 127 69 Plus
IM3-PA 39 CG16844-PA 1..38 1..42 127 69 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20115-PA 45 GI20115-PA 1..45 1..45 197 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17764-PA 45 GL17764-PA 1..45 1..45 197 82.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14796-PA 45 GA14796-PA 1..45 1..45 197 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21867-PA 45 GM21867-PA 1..45 1..45 215 93.3 Plus
Dsec\GM21866-PA 45 GM21866-PA 1..45 1..45 192 82.2 Plus
Dsec\GM21868-PA 45 GM21868-PA 1..45 1..45 146 80 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11364-PA 45 GD11364-PA 1..45 1..45 214 91.1 Plus
Dsim\GD11365-PA 45 GD11365-PA 1..45 1..45 197 82.2 Plus
Dsim\GD11363-PA 45 GD11363-PA 1..45 1..45 191 82.2 Plus
Dsim\GD11366-PA 39 GD11366-PA 1..39 1..43 122 67.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19885-PA 45 GJ19885-PA 1..45 1..45 193 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23232-PA 68 GK23232-PA 1..45 1..45 201 82.2 Plus
Dwil\GK22977-PA 45 GK22977-PA 1..45 1..45 197 82.2 Plus

FI01448.hyp Sequence

Translation from 71 to 208

> FI01448.hyp
MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*

FI01448.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG18107-PA 45 CG18107-PA 1..45 1..45 234 100 Plus
IM2-PA 45 CG18106-PA 1..45 1..45 202 80 Plus
IM1-PA 45 CG18108-PA 1..45 1..45 202 82.2 Plus
IM3-PB 39 CG16844-PB 1..38 1..42 127 69 Plus
IM3-PA 39 CG16844-PA 1..38 1..42 127 69 Plus