Clone FI01455 Report

Search the DGRC for FI01455

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:55
Vector:pFlc-1
Associated Gene/Transcriptawd-RC
Protein status:FI01455.pep: gold
Sequenced Size:651

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
awd 2008-04-29 Release 5.5 accounting
awd 2008-08-15 Release 5.9 accounting
awd 2008-12-18 5.12 accounting

Clone Sequence Records

FI01455.complete Sequence

651 bp assembled on 2007-09-04

GenBank Submission: BT030786

> FI01455.complete
GATTCGGGATTTTTTTGCAACGGCGAACACATGAAGCTCCTGATGCTCGG
CACAATTTTGGCATTCTTTTCTGTAATCTCGGCGACAATGGCGGCTAACA
AGGAGAGGACTTTCATCATGGTCAAGCCCGATGGCGTCCAGCGCGGGCTC
GTCGGCAAGATCATCGAGCGCTTCGAGCAGAAGGGCTTCAAGCTGGTCGC
CCTGAAGTTCACCTGGGCCTCCAAGGAGCTGCTGGAGAAGCACTACGCTG
ATCTGTCCGCCCGCCCCTTCTTCCCCGGACTCGTGAACTACATGAACTCC
GGCCCCGTGGTGCCCATGGTGTGGGAGGGTCTGAATGTGGTCAAGACCGG
TCGCCAGATGCTCGGCGCCACCAACCCCGCCGACTCGCTGCCCGGCACCA
TCCGCGGTGACTTCTGCATTCAGGTCGGACGCAACATCATCCACGGCTCC
GATGCCGTCGAGTCTGCCGAGAAGGAGATCGCCCTGTGGTTCAACGAAAA
GGAGCTGGTCACCTGGACCCCGGCCGCCAAGGACTGGATCTACGAATAGA
CGGCTACTTTAACTGTCTGCCCTCGTCTAAGCTGAATACAGATTGATTCT
TCTAAAGAAATAAAATTCCACAATAATTACTATATAAAAAAAAAAAAAAA
A

FI01455.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
awd-RA 717 awd-RA 69..704 2..637 3180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27567523..27567942 635..216 2100 100 Minus
chr3R 27901430 chr3R 27568120..27568335 217..2 1080 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31745170..31745591 637..216 2110 100 Minus
3R 32079331 3R 31745769..31745984 217..2 1080 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31486001..31486422 637..216 2110 100 Minus
3R 31820162 3R 31486600..31486815 217..2 1080 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:09:48 has no hits.

FI01455.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:10:59 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27567523..27567941 217..635 100 <- Minus
chr3R 27568121..27568335 1..216 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:01 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RA 1..519 31..549 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:35 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RA 1..519 31..549 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:48 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RC 1..507 43..549 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:00 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RA 1..519 31..549 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:24:22 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RC 1..507 43..549 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:45 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RA 48..683 1..635 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:35 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RA 1..634 2..635 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:48 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RC 1..634 2..635 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:00 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RA 48..683 1..635 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:24:22 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
awd-RC 1..634 2..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:10:59 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31745172..31745590 217..635 100 <- Minus
3R 31745770..31745984 1..216 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:10:59 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31745172..31745590 217..635 100 <- Minus
3R 31745770..31745984 1..216 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:10:59 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31745172..31745590 217..635 100 <- Minus
3R 31745770..31745984 1..216 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:48 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27570894..27571312 217..635 100 <- Minus
arm_3R 27571492..27571706 1..216 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:21 Download gff for FI01455.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31486003..31486421 217..635 100 <- Minus
3R 31486601..31486815 1..216 99   Minus

FI01455.hyp Sequence

Translation from 3 to 548

> FI01455.hyp
SGFFCNGEHMKLLMLGTILAFFSVISATMAANKERTFIMVKPDGVQRGLV
GKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSG
PVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSD
AVESAEKEIALWFNEKELVTWTPAAKDWIYE*

FI01455.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
awd-PD 168 CG2210-PD 1..168 14..181 877 100 Plus
awd-PC 168 CG2210-PC 1..168 14..181 877 100 Plus
awd-PE 153 CG2210-PE 1..153 29..181 808 100 Plus
nmdyn-D6-PA 151 CG5310-PA 2..147 34..176 156 29.5 Plus

FI01455.pep Sequence

Translation from 30 to 548

> FI01455.pep
MKLLMLGTILAFFSVISATMAANKERTFIMVKPDGVQRGLVGKIIERFEQ
KGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEG
LNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEI
ALWFNEKELVTWTPAAKDWIYE*

FI01455.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22983-PA 152 GF22983-PA 2..152 22..172 786 96 Plus
Dana\GF22564-PA 150 GF22564-PA 2..139 25..159 167 31.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11858-PA 172 GG11858-PA 1..172 1..172 909 100 Plus
Dere\GG17849-PA 150 GG17849-PA 2..147 25..167 165 28.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18934-PA 153 GH18934-PA 1..153 20..172 797 96.7 Plus
Dgri\GH11937-PA 153 GH11937-PA 2..136 25..156 152 26.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
awd-PD 168 CG2210-PD 1..168 5..172 877 100 Plus
awd-PC 168 CG2210-PC 1..168 5..172 877 100 Plus
awd-PE 153 CG2210-PE 1..153 20..172 808 100 Plus
nmdyn-D6-PA 151 CG5310-PA 2..147 25..167 156 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24450-PA 153 GI24450-PA 1..153 20..172 801 97.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23527-PA 153 GL23527-PA 1..153 20..172 813 99.3 Plus
Dper\GL19729-PA 114 GL19729-PA 15..75 28..88 214 68.9 Plus
Dper\GL20145-PA 152 GL20145-PA 3..137 25..156 158 26.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27289-PA 153 GA27289-PA 1..153 20..172 813 99.3 Plus
Dpse\GA28916-PA 182 GA28916-PA 80..143 18..88 214 64.8 Plus
Dpse\GA18797-PA 152 GA18797-PA 3..137 25..156 157 26.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16421-PA 153 GM16421-PA 1..153 20..172 817 100 Plus
Dsec\GM17681-PA 151 GM17681-PA 2..136 25..156 174 30.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16337-PA 172 GD16337-PA 1..172 1..172 903 99.4 Plus
Dsim\GD17175-PA 151 GD17175-PA 2..147 25..167 175 29.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24119-PA 153 GJ24119-PA 1..153 20..172 792 95.4 Plus
Dvir\GJ19086-PA 147 GJ19086-PA 2..136 25..156 165 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10972-PA 153 GK10972-PA 1..153 20..172 807 98 Plus
Dwil\GK19226-PA 139 GK19226-PA 5..138 26..159 309 44 Plus
Dwil\GK14697-PA 152 GK14697-PA 2..136 25..156 167 29.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\awd-PA 172 GE23305-PA 1..172 1..172 909 100 Plus
Dyak\GE17148-PA 150 GE17148-PA 2..147 25..167 169 28.8 Plus