BDGP Sequence Production Resources |
Search the DGRC for FI01460
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 14 |
Well: | 60 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG18598-RA |
Protein status: | FI01460.pep: gold |
Sequenced Size: | 377 |
Gene | Date | Evidence |
---|---|---|
CG18598 | 2008-04-29 | Release 5.5 accounting |
CG18598 | 2008-08-15 | Release 5.9 accounting |
CG18598 | 2008-12-18 | 5.12 accounting |
377 bp assembled on 2007-09-04
GenBank Submission: BT030788
> FI01460.complete GAGTTGCGAAACGTTGCTCGAGTCTCGGAGATGGCACTGCAGCTGCAAAT TGAGAAGCTCAAAGGTTTGGACAACTACAAGGCCTGGTCGATGACGGTGC GGGCGTATCTGGAGTCGGAGGAACTCTGGACGGTGGTGGAGAATGGTCCC GAGAACAACGAGGAGTCCCTGCTAAAGGACAAGCGGGCCAAGTTCTTGAT TCTCTGCCTGATCGAGACCAAGTTGTGCCAATTCATGGTCAGCATCCGCA CGGCTCGGGATCTGTGGAATTACTTGCGCACCCAGCATTCGCTGCGTTAA AGTAGAAATCAATATAGATCAGTTTCAGTCCATTGTATTACAAATATATG AATTACACTTCAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14075408..14075572 | 1..165 | 99 | -> | Plus |
chr3R | 14075638..14075833 | 166..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 1..270 | 31..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 1..270 | 31..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 1..270 | 31..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 1..270 | 31..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 1..270 | 31..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 2..361 | 2..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 2..361 | 2..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 2..361 | 2..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 2..361 | 2..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18598-RA | 1..360 | 2..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18251344..18251539 | 166..361 | 100 | Plus | |
3R | 18251114..18251278 | 1..165 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18251344..18251539 | 166..361 | 100 | Plus | |
3R | 18251114..18251278 | 1..165 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18251344..18251539 | 166..361 | 100 | Plus | |
3R | 18251114..18251278 | 1..165 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14076836..14077000 | 1..165 | 99 | -> | Plus |
arm_3R | 14077066..14077261 | 166..361 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17991945..17992109 | 1..165 | 99 | -> | Plus |
3R | 17992175..17992370 | 166..361 | 100 | Plus |
Translation from 30 to 299
> FI01460.pep MALQLQIEKLKGLDNYKAWSMTVRAYLESEELWTVVENGPENNEESLLKD KRAKFLILCLIETKLCQFMVSIRTARDLWNYLRTQHSLR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23074-PA | 89 | GF23074-PA | 1..89 | 1..89 | 458 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22792-PA | 89 | GG22792-PA | 1..89 | 1..89 | 464 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18561-PA | 89 | GH18561-PA | 1..89 | 1..89 | 420 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18598-PA | 89 | CG18598-PA | 1..89 | 1..89 | 461 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24761-PA | 89 | GI24761-PA | 1..89 | 1..89 | 457 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21791-PA | 89 | GL21791-PA | 1..89 | 1..89 | 448 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15008-PA | 89 | GA15008-PA | 1..89 | 1..89 | 448 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15293-PA | 89 | GM15293-PA | 1..89 | 1..89 | 464 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19220-PA | 89 | GD19220-PA | 1..89 | 1..89 | 464 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22547-PA | 89 | GJ22547-PA | 1..89 | 1..89 | 451 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22389-PA | 89 | GK22389-PA | 1..89 | 1..89 | 448 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25527-PA | 89 | GE25527-PA | 1..89 | 1..89 | 464 | 100 | Plus |
Translation from 30 to 299
> FI01460.hyp MALQLQIEKLKGLDNYKAWSMTVRAYLESEELWTVVENGPENNEESLLKD KRAKFLILCLIETKLCQFMVSIRTARDLWNYLRTQHSLR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18598-PA | 89 | CG18598-PA | 1..89 | 1..89 | 461 | 100 | Plus |