Clone FI01460 Report

Search the DGRC for FI01460

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG18598-RA
Protein status:FI01460.pep: gold
Sequenced Size:377

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18598 2008-04-29 Release 5.5 accounting
CG18598 2008-08-15 Release 5.9 accounting
CG18598 2008-12-18 5.12 accounting

Clone Sequence Records

FI01460.complete Sequence

377 bp assembled on 2007-09-04

GenBank Submission: BT030788

> FI01460.complete
GAGTTGCGAAACGTTGCTCGAGTCTCGGAGATGGCACTGCAGCTGCAAAT
TGAGAAGCTCAAAGGTTTGGACAACTACAAGGCCTGGTCGATGACGGTGC
GGGCGTATCTGGAGTCGGAGGAACTCTGGACGGTGGTGGAGAATGGTCCC
GAGAACAACGAGGAGTCCCTGCTAAAGGACAAGCGGGCCAAGTTCTTGAT
TCTCTGCCTGATCGAGACCAAGTTGTGCCAATTCATGGTCAGCATCCGCA
CGGCTCGGGATCTGTGGAATTACTTGCGCACCCAGCATTCGCTGCGTTAA
AGTAGAAATCAATATAGATCAGTTTCAGTCCATTGTATTACAAATATATG
AATTACACTTCAAAAAAAAAAAAAAAA

FI01460.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG18598-RA 449 CG18598-RA 89..449 2..362 1805 100 Plus
CG18598.b 716 CG18598.b 356..716 2..362 1805 100 Plus
CG18598.a 827 CG18598.a 467..827 2..362 1805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14075636..14075833 164..361 990 100 Plus
chr3R 27901430 chr3R 14075409..14075572 2..165 820 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18251342..18251540 164..362 995 100 Plus
3R 32079331 3R 18251115..18251278 2..165 820 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17992173..17992371 164..362 995 100 Plus
3R 31820162 3R 17991946..17992109 2..165 820 100 Plus
Blast to na_te.dros performed 2019-03-16 20:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 163..212 205..254 106 68 Plus
412 7567 412 412 7567bp 7216..7265 205..254 106 68 Plus

FI01460.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:27:30 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14075408..14075572 1..165 99 -> Plus
chr3R 14075638..14075833 166..361 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:03 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 1..270 31..300 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:36 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 1..270 31..300 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:07:36 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 1..270 31..300 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:01 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 1..270 31..300 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:49 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 1..270 31..300 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:50 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 2..361 2..361 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:36 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 2..361 2..361 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:07:36 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 2..361 2..361 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:01 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 2..361 2..361 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:49 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
CG18598-RA 1..360 2..361 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:30 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18251344..18251539 166..361 100   Plus
3R 18251114..18251278 1..165 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:30 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18251344..18251539 166..361 100   Plus
3R 18251114..18251278 1..165 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:30 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18251344..18251539 166..361 100   Plus
3R 18251114..18251278 1..165 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:07:36 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14076836..14077000 1..165 99 -> Plus
arm_3R 14077066..14077261 166..361 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:22 Download gff for FI01460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17991945..17992109 1..165 99 -> Plus
3R 17992175..17992370 166..361 100   Plus

FI01460.pep Sequence

Translation from 30 to 299

> FI01460.pep
MALQLQIEKLKGLDNYKAWSMTVRAYLESEELWTVVENGPENNEESLLKD
KRAKFLILCLIETKLCQFMVSIRTARDLWNYLRTQHSLR*

FI01460.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23074-PA 89 GF23074-PA 1..89 1..89 458 97.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22792-PA 89 GG22792-PA 1..89 1..89 464 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18561-PA 89 GH18561-PA 1..89 1..89 420 86.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18598-PA 89 CG18598-PA 1..89 1..89 461 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24761-PA 89 GI24761-PA 1..89 1..89 457 97.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21791-PA 89 GL21791-PA 1..89 1..89 448 94.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15008-PA 89 GA15008-PA 1..89 1..89 448 94.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15293-PA 89 GM15293-PA 1..89 1..89 464 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19220-PA 89 GD19220-PA 1..89 1..89 464 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22547-PA 89 GJ22547-PA 1..89 1..89 451 96.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22389-PA 89 GK22389-PA 1..89 1..89 448 94.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25527-PA 89 GE25527-PA 1..89 1..89 464 100 Plus

FI01460.hyp Sequence

Translation from 30 to 299

> FI01460.hyp
MALQLQIEKLKGLDNYKAWSMTVRAYLESEELWTVVENGPENNEESLLKD
KRAKFLILCLIETKLCQFMVSIRTARDLWNYLRTQHSLR*

FI01460.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG18598-PA 89 CG18598-PA 1..89 1..89 461 100 Plus