Clone FI01462 Report

Search the DGRC for FI01462

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:62
Vector:pFlc-1
Associated Gene/TranscriptCG5773-RA
Protein status:FI01462.pep: gold
Sequenced Size:603

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5773 2008-04-29 Release 5.5 accounting
CG5773 2008-08-15 Release 5.9 accounting
CG5773 2008-12-18 5.12 accounting

Clone Sequence Records

FI01462.complete Sequence

603 bp assembled on 2007-09-04

GenBank Submission: BT030789

> FI01462.complete
GATCGGCGATACATTCAATTATCTCTCCGGTTTGCGACTGTTGGCGCTTT
AAAGTGTGCCCACACACAGTGGCTTGTGCTCAGTCGAATTTTGTTCTCGG
ACCATTAAACATTACCCATTCAGCCAGCATTCACCATTCCAACATTCGAC
ATTCAACATGGAAGGCCAACGCGTGGCAGTCGTCGCATTTGCTGTTTTGC
TCGCCGGATTGTGCGTGCTATCCGGTCTGAATGCGGCACCCGTGGAATGC
AATAATGGCGGTGGCATCCAGATCTCTGACGATGGTTTCCAGAGCCAGAC
GCAAACCGGTCCCGGCTGCCAGACCCAGACCTCCGAGGATGGAACCCAGA
GCCAAAGCCAGAGTCAGTCGGGCAATGGCTACCAATCGCAGACGCAGTGC
AGCGGCTCATCCTGTGGTCAGTTCAACACCTTCCCGCCGCTATTCACCAT
TAAGCCGCTGGAGCCATTGGCACCCATCACTTGGCAGCCATGGGGGCAAA
TGAGGAACAACCAGGTGCAGCAGCAGGTCAATTTTGGCTAAGTTTTGGAA
AAAAAAGTATTCAAGTTAATAAAGATTTTGAATTTGTAAAAAAAAAAAAA
AAA

FI01462.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5773-RA 811 CG5773-RA 63..650 2..589 2940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13930204..13930557 585..233 1645 98.3 Minus
chr2R 21145070 chr2R 13930649..13930887 233..2 1055 97.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18043065..18043421 589..233 1785 100 Minus
2R 25286936 2R 18043513..18043744 233..2 1160 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18044264..18044620 589..233 1785 100 Minus
2R 25260384 2R 18044712..18044943 233..2 1160 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:54:52 has no hits.

FI01462.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:55:51 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13930202..13930559 227..587 96 -> Minus
chr2R 13930656..13930887 1..226 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:05 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:37 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:49:55 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:05 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:16 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:54 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..586 2..587 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:37 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..586 2..587 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:49:55 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..586 2..587 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:05 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..586 2..587 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:16 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
CG5773-RA 1..586 2..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:51 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18043067..18043421 233..587 100 <- Minus
2R 18043514..18043744 1..232 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:51 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18043067..18043421 233..587 100 <- Minus
2R 18043514..18043744 1..232 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:55:51 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18043067..18043421 233..587 100 <- Minus
2R 18043514..18043744 1..232 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:49:55 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13930572..13930926 233..587 100 <- Minus
arm_2R 13931019..13931249 1..232 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:24 Download gff for FI01462.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18044266..18044620 233..587 100 <- Minus
2R 18044713..18044943 1..232 99   Minus

FI01462.hyp Sequence

Translation from 157 to 540

> FI01462.hyp
MEGQRVAVVAFAVLLAGLCVLSGLNAAPVECNNGGGIQISDDGFQSQTQT
GPGCQTQTSEDGTQSQSQSQSGNGYQSQTQCSGSSCGQFNTFPPLFTIKP
LEPLAPITWQPWGQMRNNQVQQQVNFG*

FI01462.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG5773-PC 127 CG5773-PC 1..127 1..127 679 100 Plus
CG5773-PB 127 CG5773-PB 1..127 1..127 679 100 Plus
CG5773-PA 127 CG5773-PA 1..127 1..127 679 100 Plus

FI01462.pep Sequence

Translation from 157 to 540

> FI01462.pep
MEGQRVAVVAFAVLLAGLCVLSGLNAAPVECNNGGGIQISDDGFQSQTQT
GPGCQTQTSEDGTQSQSQSQSGNGYQSQTQCSGSSCGQFNTFPPLFTIKP
LEPLAPITWQPWGQMRNNQVQQQVNFG*

FI01462.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13212-PA 134 GF13212-PA 1..108 1..111 406 80.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21003-PA 127 GG21003-PA 1..127 1..127 485 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG5773-PC 127 CG5773-PC 1..127 1..127 679 100 Plus
CG5773-PB 127 CG5773-PB 1..127 1..127 679 100 Plus
CG5773-PA 127 CG5773-PA 1..127 1..127 679 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19282-PA 119 GI19282-PA 7..119 6..118 196 55.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10544-PA 141 GL10544-PA 21..124 15..116 272 68.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19118-PA 141 GA19118-PA 21..124 15..116 272 68.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19936-PA 127 GM19936-PA 1..127 1..127 619 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25425-PA 127 GD25425-PA 1..127 1..127 634 96.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22159-PA 119 GJ22159-PA 7..118 6..112 244 52.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13946-PA 127 GE13946-PA 1..127 1..127 456 85 Plus