Clone FI01465 Report

Search the DGRC for FI01465

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:65
Vector:pFlc-1
Associated Gene/TranscriptGos28-RA
Protein status:FI01465.pep: gold
Sequenced Size:905

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Gos28 2008-04-29 Release 5.5 accounting
Gos28 2008-08-15 Release 5.9 accounting
Gos28 2008-12-18 5.12 accounting

Clone Sequence Records

FI01465.complete Sequence

905 bp assembled on 2007-09-05

GenBank Submission: BT030790

> FI01465.complete
GACACCGATTGCCACACGAAAGTCGAACAAATAAAGGAAAACTATTTTTG
ACAAATGGGAGGATCCAGCTACGATGTGCTCAGGAAGCAGGCGCGGAGCC
TGGAAAACGAGATCGACCTGAAGCTGGTGGCATTCAGCAAAATCGGAGCT
GGCAGTGGAGGAGGTGGAAGTGGAGGACTAGGAGGCGTTGACACATCGCC
GCTCCTGGGCGAGCACGTCTTCGATTCGCTGTCGGAGGAGATCGAGCAAA
TGCTGGAGAAGCTATCCTCGCTAAATGAGTCCATGTCCGATTTGCCCGCC
TCTGGAGCAGCCGCCATGCACACACTGCAGAGGCATCGAGAGATCCTGCA
GGGGTATCGCCAGGAGTTCAATAAGATCTGCGCCAATCACACAATGCGAA
TCGAGCGAGAGGAGCTGCTTCGTGGCTCAGGGTTGGCCACCAGCTCCGGC
AGTCCATCCATCTCGGGCCTAAACCGGCGAGAAATGTACCTGAAGGAGAG
CGGGCACCTCAACAGCGCCAGTCACTTGGTCAACGATCAGATAAATATCG
CGATTGAGACGCGTGACCATCTTCACGCCCAGCGACAAGCATTCAAGCGG
CTGCAGACCCGCTTTAACGATATCTCCAATCGATTCCCACTGATTTCCAG
TCTCATTCAGCGCATCAACATTAAAAAGCGACGCGATTCGCTGATCCTGG
GAGCAGTTATTGGCTTCTGTGTGATCTTGCTGCTGCTCTACGCCTTCAAC
TAGTGACCCGCCACCGCGATTTGGCCAAAGATAGAGCTTGCATTAAACTC
CATTACAGACAATTGAATTTTAGTTTGTTTTTTCCGACGGTATATGTGTA
TGATTAACTTGTGATAGCAATAAAATGTACTATATAAGACAAAAAAAAAA
AAAAA

FI01465.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Gos28-RA 915 Gos28-RA 17..909 2..894 4465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14488730..14489120 260..650 1955 100 Plus
chr3R 27901430 chr3R 14489188..14489431 648..890 1155 99.2 Plus
chr3R 27901430 chr3R 14488005..14488190 76..261 930 100 Plus
chr3R 27901430 chr3R 14487866..14487940 2..76 375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18664607..18664997 260..650 1955 100 Plus
3R 32079331 3R 18665065..18665311 648..894 1235 100 Plus
3R 32079331 3R 18663882..18664067 76..261 930 100 Plus
3R 32079331 3R 18663743..18663817 2..76 375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18405438..18405828 260..650 1955 100 Plus
3R 31820162 3R 18405896..18406142 648..894 1235 100 Plus
3R 31820162 3R 18404713..18404898 76..261 930 100 Plus
3R 31820162 3R 18404574..18404648 2..76 375 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:33:40 has no hits.

FI01465.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:34:35 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14487865..14487940 1..76 98 -> Plus
chr3R 14488006..14488190 77..261 100 -> Plus
chr3R 14488732..14489120 262..650 100 -> Plus
chr3R 14489191..14489431 651..890 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:07 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 1..699 55..753 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:08 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 1..699 55..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:55:44 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 1..699 55..753 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:33 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 1..699 55..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:39 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 1..699 55..753 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:39:28 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 2..885 2..885 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:08 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 2..890 2..890 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:55:44 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 2..890 2..890 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:33 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 2..885 2..885 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:39 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
Gos28-RA 5..894 1..890 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:35 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18663883..18664067 77..261 100 -> Plus
3R 18663742..18663817 1..76 98 -> Plus
3R 18664609..18664997 262..650 100 -> Plus
3R 18665068..18665307 651..890 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:35 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18663883..18664067 77..261 100 -> Plus
3R 18663742..18663817 1..76 98 -> Plus
3R 18664609..18664997 262..650 100 -> Plus
3R 18665068..18665307 651..890 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:35 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18663883..18664067 77..261 100 -> Plus
3R 18663742..18663817 1..76 98 -> Plus
3R 18664609..18664997 262..650 100 -> Plus
3R 18665068..18665307 651..890 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:55:44 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14489464..14489539 1..76 98 -> Plus
arm_3R 14489605..14489789 77..261 100 -> Plus
arm_3R 14490331..14490719 262..650 100 -> Plus
arm_3R 14490790..14491029 651..890 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:58 Download gff for FI01465.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18405899..18406138 651..890 100   Plus
3R 18405440..18405828 262..650 100 -> Plus
3R 18404573..18404648 1..76 98 -> Plus
3R 18404714..18404898 77..261 100 -> Plus

FI01465.hyp Sequence

Translation from 54 to 752

> FI01465.hyp
MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPL
LGEHVFDSLSEEIEQMLEKLSSLNESMSDLPASGAAAMHTLQRHREILQG
YRQEFNKICANHTMRIEREELLRGSGLATSSGSPSISGLNRREMYLKESG
HLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRFPLISSL
IQRINIKKRRDSLILGAVIGFCVILLLLYAFN*

FI01465.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Gos28-PA 232 CG7700-PA 1..232 1..232 1161 100 Plus

FI01465.pep Sequence

Translation from 54 to 752

> FI01465.pep
MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPL
LGEHVFDSLSEEIEQMLEKLSSLNESMSDLPASGAAAMHTLQRHREILQG
YRQEFNKICANHTMRIEREELLRGSGLATSSGSPSISGLNRREMYLKESG
HLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRFPLISSL
IQRINIKKRRDSLILGAVIGFCVILLLLYAFN*

FI01465.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16913-PA 233 GF16913-PA 1..233 1..232 1170 97.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23002-PA 232 GG23002-PA 1..232 1..232 1199 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18353-PA 233 GH18353-PA 1..233 1..232 1003 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Gos28-PA 232 CG7700-PA 1..232 1..232 1161 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23338-PA 230 GI23338-PA 1..230 1..232 1013 87.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24358-PA 232 GL24358-PA 1..232 1..232 1011 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20527-PA 232 GA20527-PA 1..232 1..232 1011 88.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17878-PA 238 GM17878-PA 1..238 1..232 953 88.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19238-PA 232 GD19238-PA 1..232 1..232 1203 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10337-PA 231 GJ10337-PA 1..231 1..232 1039 90.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12206-PA 229 GK12206-PA 1..229 1..232 1061 89.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25547-PA 232 GE25547-PA 1..232 1..232 1194 99.1 Plus