BDGP Sequence Production Resources |
Search the DGRC for FI01465
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 14 |
Well: | 65 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Gos28-RA |
Protein status: | FI01465.pep: gold |
Sequenced Size: | 905 |
Gene | Date | Evidence |
---|---|---|
Gos28 | 2008-04-29 | Release 5.5 accounting |
Gos28 | 2008-08-15 | Release 5.9 accounting |
Gos28 | 2008-12-18 | 5.12 accounting |
905 bp assembled on 2007-09-05
GenBank Submission: BT030790
> FI01465.complete GACACCGATTGCCACACGAAAGTCGAACAAATAAAGGAAAACTATTTTTG ACAAATGGGAGGATCCAGCTACGATGTGCTCAGGAAGCAGGCGCGGAGCC TGGAAAACGAGATCGACCTGAAGCTGGTGGCATTCAGCAAAATCGGAGCT GGCAGTGGAGGAGGTGGAAGTGGAGGACTAGGAGGCGTTGACACATCGCC GCTCCTGGGCGAGCACGTCTTCGATTCGCTGTCGGAGGAGATCGAGCAAA TGCTGGAGAAGCTATCCTCGCTAAATGAGTCCATGTCCGATTTGCCCGCC TCTGGAGCAGCCGCCATGCACACACTGCAGAGGCATCGAGAGATCCTGCA GGGGTATCGCCAGGAGTTCAATAAGATCTGCGCCAATCACACAATGCGAA TCGAGCGAGAGGAGCTGCTTCGTGGCTCAGGGTTGGCCACCAGCTCCGGC AGTCCATCCATCTCGGGCCTAAACCGGCGAGAAATGTACCTGAAGGAGAG CGGGCACCTCAACAGCGCCAGTCACTTGGTCAACGATCAGATAAATATCG CGATTGAGACGCGTGACCATCTTCACGCCCAGCGACAAGCATTCAAGCGG CTGCAGACCCGCTTTAACGATATCTCCAATCGATTCCCACTGATTTCCAG TCTCATTCAGCGCATCAACATTAAAAAGCGACGCGATTCGCTGATCCTGG GAGCAGTTATTGGCTTCTGTGTGATCTTGCTGCTGCTCTACGCCTTCAAC TAGTGACCCGCCACCGCGATTTGGCCAAAGATAGAGCTTGCATTAAACTC CATTACAGACAATTGAATTTTAGTTTGTTTTTTCCGACGGTATATGTGTA TGATTAACTTGTGATAGCAATAAAATGTACTATATAAGACAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gos28-RA | 915 | Gos28-RA | 17..909 | 2..894 | 4465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14488730..14489120 | 260..650 | 1955 | 100 | Plus |
chr3R | 27901430 | chr3R | 14489188..14489431 | 648..890 | 1155 | 99.2 | Plus |
chr3R | 27901430 | chr3R | 14488005..14488190 | 76..261 | 930 | 100 | Plus |
chr3R | 27901430 | chr3R | 14487866..14487940 | 2..76 | 375 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18664607..18664997 | 260..650 | 1955 | 100 | Plus |
3R | 32079331 | 3R | 18665065..18665311 | 648..894 | 1235 | 100 | Plus |
3R | 32079331 | 3R | 18663882..18664067 | 76..261 | 930 | 100 | Plus |
3R | 32079331 | 3R | 18663743..18663817 | 2..76 | 375 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18405438..18405828 | 260..650 | 1955 | 100 | Plus |
3R | 31820162 | 3R | 18405896..18406142 | 648..894 | 1235 | 100 | Plus |
3R | 31820162 | 3R | 18404713..18404898 | 76..261 | 930 | 100 | Plus |
3R | 31820162 | 3R | 18404574..18404648 | 2..76 | 375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14487865..14487940 | 1..76 | 98 | -> | Plus |
chr3R | 14488006..14488190 | 77..261 | 100 | -> | Plus |
chr3R | 14488732..14489120 | 262..650 | 100 | -> | Plus |
chr3R | 14489191..14489431 | 651..890 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 1..699 | 55..753 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 1..699 | 55..753 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 1..699 | 55..753 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 1..699 | 55..753 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 1..699 | 55..753 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 2..885 | 2..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 2..890 | 2..890 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 2..890 | 2..890 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 2..885 | 2..885 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gos28-RA | 5..894 | 1..890 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18663883..18664067 | 77..261 | 100 | -> | Plus |
3R | 18663742..18663817 | 1..76 | 98 | -> | Plus |
3R | 18664609..18664997 | 262..650 | 100 | -> | Plus |
3R | 18665068..18665307 | 651..890 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18663883..18664067 | 77..261 | 100 | -> | Plus |
3R | 18663742..18663817 | 1..76 | 98 | -> | Plus |
3R | 18664609..18664997 | 262..650 | 100 | -> | Plus |
3R | 18665068..18665307 | 651..890 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18663883..18664067 | 77..261 | 100 | -> | Plus |
3R | 18663742..18663817 | 1..76 | 98 | -> | Plus |
3R | 18664609..18664997 | 262..650 | 100 | -> | Plus |
3R | 18665068..18665307 | 651..890 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14489464..14489539 | 1..76 | 98 | -> | Plus |
arm_3R | 14489605..14489789 | 77..261 | 100 | -> | Plus |
arm_3R | 14490331..14490719 | 262..650 | 100 | -> | Plus |
arm_3R | 14490790..14491029 | 651..890 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18405899..18406138 | 651..890 | 100 | Plus | |
3R | 18405440..18405828 | 262..650 | 100 | -> | Plus |
3R | 18404573..18404648 | 1..76 | 98 | -> | Plus |
3R | 18404714..18404898 | 77..261 | 100 | -> | Plus |
Translation from 54 to 752
> FI01465.hyp MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPL LGEHVFDSLSEEIEQMLEKLSSLNESMSDLPASGAAAMHTLQRHREILQG YRQEFNKICANHTMRIEREELLRGSGLATSSGSPSISGLNRREMYLKESG HLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRFPLISSL IQRINIKKRRDSLILGAVIGFCVILLLLYAFN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gos28-PA | 232 | CG7700-PA | 1..232 | 1..232 | 1161 | 100 | Plus |
Translation from 54 to 752
> FI01465.pep MGGSSYDVLRKQARSLENEIDLKLVAFSKIGAGSGGGGSGGLGGVDTSPL LGEHVFDSLSEEIEQMLEKLSSLNESMSDLPASGAAAMHTLQRHREILQG YRQEFNKICANHTMRIEREELLRGSGLATSSGSPSISGLNRREMYLKESG HLNSASHLVNDQINIAIETRDHLHAQRQAFKRLQTRFNDISNRFPLISSL IQRINIKKRRDSLILGAVIGFCVILLLLYAFN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16913-PA | 233 | GF16913-PA | 1..233 | 1..232 | 1170 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23002-PA | 232 | GG23002-PA | 1..232 | 1..232 | 1199 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18353-PA | 233 | GH18353-PA | 1..233 | 1..232 | 1003 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gos28-PA | 232 | CG7700-PA | 1..232 | 1..232 | 1161 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23338-PA | 230 | GI23338-PA | 1..230 | 1..232 | 1013 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24358-PA | 232 | GL24358-PA | 1..232 | 1..232 | 1011 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20527-PA | 232 | GA20527-PA | 1..232 | 1..232 | 1011 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17878-PA | 238 | GM17878-PA | 1..238 | 1..232 | 953 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19238-PA | 232 | GD19238-PA | 1..232 | 1..232 | 1203 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10337-PA | 231 | GJ10337-PA | 1..231 | 1..232 | 1039 | 90.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12206-PA | 229 | GK12206-PA | 1..229 | 1..232 | 1061 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25547-PA | 232 | GE25547-PA | 1..232 | 1..232 | 1194 | 99.1 | Plus |