BDGP Sequence Production Resources |
Search the DGRC for FI01468
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 14 |
Well: | 68 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG6503-RA |
Protein status: | FI01468.pep: gold |
Sequenced Size: | 425 |
Gene | Date | Evidence |
---|---|---|
CG6503 | 2008-04-29 | Release 5.5 accounting |
CG6503 | 2008-08-15 | Release 5.9 accounting |
CG6503 | 2008-12-18 | 5.12 accounting |
425 bp assembled on 2007-09-04
GenBank Submission: BT030791
> FI01468.complete GAAAATAGTTGCATTTTCTAGTTGCCCAAGGTGAGTTGAGGCTGCCTAGT ATTCCAATTCAAACTACGGATTTTCTTTCAAGTGCAGAACTCGATAAGGA TTTTATAAACATGCTTTTGAAATGCACTTGGCTATTGGTTTTGCTGCTGT CCGTAATGGCAGGTGCCTTTGCCAGCAGCGGATGTCCTGCGGGATATAGT GCCGAGAACAATCGGTGCACCATTGAGCGTCCTGTTCACGGCTCCTGTCC ACCCGGATCCTCCTACAGCCTGAACATCAACAAGTGCGTCCACTCCTAAG GATCTCGTCGAATAAACTACAAAATGAAAATATCTTAGATAAGTGAAAAC AAAAGTGTAGAGTTGCAAAAAAGAGTAATGTGATGAATTAAAAAAAAAAA TGATAGCGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 22247721..22248118 | 399..2 | 1975 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 26424697..26425105 | 410..2 | 2045 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 26165528..26165936 | 410..2 | 2045 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy7 | 5486 | gypsy7 GYPSY7 5486bp | 301..355 | 54..108 | 104 | 65.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 22247712..22248118 | 1..409 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..189 | 111..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RB | 1..189 | 111..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..189 | 111..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..189 | 111..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..189 | 111..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..408 | 2..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..408 | 2..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..408 | 2..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..408 | 2..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6503-RA | 1..408 | 2..409 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26424698..26425105 | 1..409 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26424698..26425105 | 1..409 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26424698..26425105 | 1..409 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 22250420..22250827 | 1..409 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 26165529..26165936 | 1..409 | 99 | Minus |
Translation from 110 to 298
> FI01468.hyp MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS SYSLNINKCVHS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6503-PB | 62 | CG6503-PB | 1..62 | 1..62 | 336 | 100 | Plus |
CG6503-PC | 62 | CG6503-PC | 1..62 | 1..62 | 336 | 100 | Plus |
CG6503-PA | 62 | CG6503-PA | 1..62 | 1..62 | 336 | 100 | Plus |
CG34291-PA | 61 | CG34291-PA | 4..59 | 6..61 | 135 | 35.7 | Plus |
Translation from 110 to 298
> FI01468.pep MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS SYSLNINKCVHS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19743-PA | 61 | GF19743-PA | 4..60 | 6..62 | 135 | 40.4 | Plus |
Dana\GF20728-PA | 61 | GF20728-PA | 4..59 | 6..61 | 135 | 41.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12189-PA | 75 | GG12189-PA | 4..75 | 6..62 | 243 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18176-PA | 61 | GH18176-PA | 1..61 | 1..62 | 203 | 59.7 | Plus |
Dgri\GH18175-PA | 61 | GH18175-PA | 4..59 | 6..61 | 129 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6503-PB | 62 | CG6503-PB | 1..62 | 1..62 | 336 | 100 | Plus |
CG6503-PC | 62 | CG6503-PC | 1..62 | 1..62 | 336 | 100 | Plus |
CG6503-PA | 62 | CG6503-PA | 1..62 | 1..62 | 336 | 100 | Plus |
CG34291-PA | 61 | CG34291-PA | 4..59 | 6..61 | 135 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10127-PA | 61 | GI10127-PA | 1..61 | 1..62 | 185 | 64.5 | Plus |
Dmoj\GI10126-PA | 60 | GI10126-PA | 4..58 | 6..61 | 154 | 44.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21998-PA | 61 | GL21998-PA | 16..61 | 16..62 | 182 | 72.3 | Plus |
Dper\GL21997-PA | 62 | GL21997-PA | 4..61 | 6..62 | 126 | 41.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27339-PA | 61 | GA27339-PA | 16..61 | 16..62 | 182 | 72.3 | Plus |
Dpse\GA27338-PA | 62 | GA27338-PA | 4..61 | 6..62 | 124 | 41.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10185-PA | 62 | GM10185-PA | 1..62 | 1..62 | 317 | 98.4 | Plus |
Dsec\GM10184-PA | 61 | GM10184-PA | 4..60 | 6..62 | 134 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18137-PA | 62 | GD18137-PA | 1..62 | 1..62 | 317 | 98.4 | Plus |
Dsim\GD18136-PA | 61 | GD18136-PA | 4..60 | 6..62 | 130 | 35.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23348-PA | 61 | GJ23348-PA | 1..61 | 1..62 | 169 | 59.7 | Plus |
Dvir\GJ23347-PA | 61 | GJ23347-PA | 4..59 | 6..61 | 136 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13310-PA | 61 | GK13310-PA | 4..60 | 6..62 | 142 | 42.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10631-PA | 75 | GE10631-PA | 4..75 | 6..62 | 238 | 65.3 | Plus |