Clone FI01468 Report

Search the DGRC for FI01468

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:14
Well:68
Vector:pFlc-1
Associated Gene/TranscriptCG6503-RA
Protein status:FI01468.pep: gold
Sequenced Size:425

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6503 2008-04-29 Release 5.5 accounting
CG6503 2008-08-15 Release 5.9 accounting
CG6503 2008-12-18 5.12 accounting

Clone Sequence Records

FI01468.complete Sequence

425 bp assembled on 2007-09-04

GenBank Submission: BT030791

> FI01468.complete
GAAAATAGTTGCATTTTCTAGTTGCCCAAGGTGAGTTGAGGCTGCCTAGT
ATTCCAATTCAAACTACGGATTTTCTTTCAAGTGCAGAACTCGATAAGGA
TTTTATAAACATGCTTTTGAAATGCACTTGGCTATTGGTTTTGCTGCTGT
CCGTAATGGCAGGTGCCTTTGCCAGCAGCGGATGTCCTGCGGGATATAGT
GCCGAGAACAATCGGTGCACCATTGAGCGTCCTGTTCACGGCTCCTGTCC
ACCCGGATCCTCCTACAGCCTGAACATCAACAAGTGCGTCCACTCCTAAG
GATCTCGTCGAATAAACTACAAAATGAAAATATCTTAGATAAGTGAAAAC
AAAAGTGTAGAGTTGCAAAAAAGAGTAATGTGATGAATTAAAAAAAAAAA
TGATAGCGGAAAAAAAAAAAAAAAA

FI01468.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-RA 409 CG6503-RA 1..409 2..410 2045 100 Plus
CG6503.a 609 CG6503.a 119..443 86..410 1625 100 Plus
CG6503.a 609 CG6503.a 92..120 2..30 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22247721..22248118 399..2 1975 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26424697..26425105 410..2 2045 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26165528..26165936 410..2 2045 100 Minus
Blast to na_te.dros performed 2019-03-15 16:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy7 5486 gypsy7 GYPSY7 5486bp 301..355 54..108 104 65.5 Plus

FI01468.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:00 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22247712..22248118 1..409 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:08 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..189 111..299 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:39 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RB 1..189 111..299 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:15:37 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..189 111..299 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:06 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..189 111..299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:05 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..189 111..299 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:37:59 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..408 2..409 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:38 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..408 2..409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:15:37 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..408 2..409 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:06 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..408 2..409 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:05 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 1..408 2..409 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:00 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26424698..26425105 1..409 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:00 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26424698..26425105 1..409 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:00 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26424698..26425105 1..409 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:15:37 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22250420..22250827 1..409 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:25 Download gff for FI01468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26165529..26165936 1..409 99   Minus

FI01468.hyp Sequence

Translation from 110 to 298

> FI01468.hyp
MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS
SYSLNINKCVHS*

FI01468.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-PB 62 CG6503-PB 1..62 1..62 336 100 Plus
CG6503-PC 62 CG6503-PC 1..62 1..62 336 100 Plus
CG6503-PA 62 CG6503-PA 1..62 1..62 336 100 Plus
CG34291-PA 61 CG34291-PA 4..59 6..61 135 35.7 Plus

FI01468.pep Sequence

Translation from 110 to 298

> FI01468.pep
MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS
SYSLNINKCVHS*

FI01468.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19743-PA 61 GF19743-PA 4..60 6..62 135 40.4 Plus
Dana\GF20728-PA 61 GF20728-PA 4..59 6..61 135 41.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12189-PA 75 GG12189-PA 4..75 6..62 243 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18176-PA 61 GH18176-PA 1..61 1..62 203 59.7 Plus
Dgri\GH18175-PA 61 GH18175-PA 4..59 6..61 129 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-PB 62 CG6503-PB 1..62 1..62 336 100 Plus
CG6503-PC 62 CG6503-PC 1..62 1..62 336 100 Plus
CG6503-PA 62 CG6503-PA 1..62 1..62 336 100 Plus
CG34291-PA 61 CG34291-PA 4..59 6..61 135 35.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10127-PA 61 GI10127-PA 1..61 1..62 185 64.5 Plus
Dmoj\GI10126-PA 60 GI10126-PA 4..58 6..61 154 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21998-PA 61 GL21998-PA 16..61 16..62 182 72.3 Plus
Dper\GL21997-PA 62 GL21997-PA 4..61 6..62 126 41.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27339-PA 61 GA27339-PA 16..61 16..62 182 72.3 Plus
Dpse\GA27338-PA 62 GA27338-PA 4..61 6..62 124 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10185-PA 62 GM10185-PA 1..62 1..62 317 98.4 Plus
Dsec\GM10184-PA 61 GM10184-PA 4..60 6..62 134 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18137-PA 62 GD18137-PA 1..62 1..62 317 98.4 Plus
Dsim\GD18136-PA 61 GD18136-PA 4..60 6..62 130 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23348-PA 61 GJ23348-PA 1..61 1..62 169 59.7 Plus
Dvir\GJ23347-PA 61 GJ23347-PA 4..59 6..61 136 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13310-PA 61 GK13310-PA 4..60 6..62 142 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10631-PA 75 GE10631-PA 4..75 6..62 238 65.3 Plus