Clone FI01546 Report

Search the DGRC for FI01546

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:15
Well:46
Vector:pFlc-1
Associated Gene/TranscriptOsi9-RA
Protein status:FI01546.pep: gold
Sequenced Size:1369

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Osi9 2008-04-29 Release 5.5 accounting
Osi9 2008-08-15 Release 5.9 accounting
Osi9 2008-12-18 5.12 accounting

Clone Sequence Records

FI01546.complete Sequence

1369 bp assembled on 2007-09-05

GenBank Submission: BT030794

> FI01546.complete
ACGGTTTACCGGTTGCCTTCTGACCGACAGATCGAACACGCCAATCGAGC
GCAGTGCACTCAATCAAGTGAACACACACACGCATCCCCGAATCGCCAGG
AAGTGGCAGGATATCAAATCAGCGCAGCAGTGTCGAGTGTTTGTGCGAAG
CATTCAAAAAAAAAATAATACAAAAAAGGAAATACCCATCACGAGCCATG
TTCAAGTTCGTGTGCCTTTTTGCGCTGATTGCCTCCACGGCGGCGGCTAC
CTCGGAAGCGGACAGCTTGCTGACCAGCGCTTTGAAGATGGTCAAGGACT
GTGGCGAACGGTCCATGGTCTTGTGCATGAAGGAGCGAGCCCTGCACTAC
TTCGATGCCGAGAACGGGGATGTGCGGCTCACCGAGGGCATTGCCCTGGT
CAAGACCGATGAGATCCCGGTGGGTCGATCCCTCAACGAGATGCAACTGC
CCGAGGAGGTTGAGGCCCGGGAGGCCGAGGTGGACTCCCTGCTGGTGGAG
CGCGTTGCCCGCTTCTTCGGCACCCACACGCTGCAGTTCAAGGTGCCCAA
AGACTCCATCCAGGACATGCAGCGCGCCCTCGAGGAATCTCGCGGCAAGA
AGAAGGAGAAGAAGAAGTACCTGATGCCCCTGCTAATGCTCTTCAAGCTG
AAGATGGCCGCCCTGCTGCCCCTGGCCATTGGCTTCCTGGCCCTGATCTC
CTTCAAGGCCCTGGTCATCGGCAAGATCGCCCTGCTGCTCTCCGGCATCA
TTGGGCTGAAGAAACTGCTCGAGTCGAAGAAGGAGAACTACGAGGTCGTT
GCGCACCCGCACTACGAGCACGAGCACAGCTACGGCCGCTCGCTGCCATC
TGATGACTCCCAGGCCCAGCAGCTGGCCTATGCGGCGTATAAGCAATAAG
CTGCATGCCAAATATTCTGAATGCTGAATGCTGAGGCAACCGTAATCAGT
GCAATACTCGGAGGGCCGTCTAATTTATCTATTTATTTAATTTATTTGTA
TAGCATAGTTCATGCCAGGCTTACACACTTAAGGCGCCATCAAGAGAAAT
AGAAGGAAAGGTAAATCCCGAACCCACACAAATAGGTCTAAGGAATCAGC
AGCTAGGGACTGCCGCCAGAGGGGACACCTGGCGTCGTTTAATCTATTCT
TAAAAATGACTGCCACTGTCGTATTAATACTCAGAGCTTTATTATTTAAA
ACTCTACGCTTAACTTAACTTAACTCAACTGAACTCTTAACCAAACTATT
AAACTAAACTGCCTAACTCTGAACTGCCGCTAGGCGCAGAAAAAGCCCCC
CTGGCCAAGCCCTCCCCCACACAAAACAATAAAAGAAATGCCGCATTTAT
TCCGAAAAAAAAAAAAAAA

FI01546.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Osi9.a 1921 Osi9.a 138..1493 4..1356 6685 99.7 Plus
Osi9-RA 1496 Osi9-RA 138..1493 4..1356 6685 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2086991..2087757 589..1354 3785 99.9 Plus
chr3R 27901430 chr3R 2085869..2086200 4..333 1595 99.4 Plus
chr3R 27901430 chr3R 2086259..2086517 330..588 1295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6261339..6262107 589..1356 3795 99.9 Plus
3R 32079331 3R 6260217..6260548 4..333 1595 99.4 Plus
3R 32079331 3R 6260607..6260865 330..588 1295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6002170..6002938 589..1356 3805 99.8 Plus
3R 31820162 3R 6001048..6001379 4..333 1605 99.3 Plus
3R 31820162 3R 6001438..6001696 330..588 1295 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:09:27 has no hits.

FI01546.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:10:06 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2085866..2086199 1..332 99 -> Plus
chr3R 2086262..2086517 333..588 100 -> Plus
chr3R 2086991..2087757 589..1354 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:16 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 1..702 198..899 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:10 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 1..702 198..899 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:56:37 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 1..702 198..899 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:36 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 1..702 198..899 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:47 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 1..702 198..899 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:39:41 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 2..1358 1..1354 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:10 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 2..1358 1..1354 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:56:37 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 4..1360 1..1354 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:39 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 2..1358 1..1354 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:47 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
Osi9-RA 4..1360 1..1354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:06 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6260610..6260865 333..588 100 -> Plus
3R 6260214..6260547 1..332 99 -> Plus
3R 6261339..6262105 589..1354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:06 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6260610..6260865 333..588 100 -> Plus
3R 6260214..6260547 1..332 99 -> Plus
3R 6261339..6262105 589..1354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:06 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6260610..6260865 333..588 100 -> Plus
3R 6260214..6260547 1..332 99 -> Plus
3R 6261339..6262105 589..1354 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:56:37 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2086332..2086587 333..588 100 -> Plus
arm_3R 2085936..2086269 1..332 99 -> Plus
arm_3R 2087061..2087827 589..1354 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:55:01 Download gff for FI01546.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6001045..6001378 1..332 99 -> Plus
3R 6001441..6001696 333..588 100 -> Plus
3R 6002170..6002936 589..1354 99   Plus

FI01546.hyp Sequence

Translation from 1 to 898

> FI01546.hyp
QFTGCLLTDRSNTPIERSALNQVNTHTRIPESPGSGRISNQRSSVECLCE
AFKKKIIQKRKYPSRAMFKFVCLFALIASTAAATSEADSLLTSALKMVKD
CGERSMVLCMKERALHYFDAENGDVRLTEGIALVKTDEIPVGRSLNEMQL
PEEVEAREAEVDSLLVERVARFFGTHTLQFKVPKDSIQDMQRALEESRGK
KKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIGKIALLLSGI
IGLKKLLESKKENYEVVAHPHYEHEHSYGRSLPSDDSQAQQLAYAAYKQ*

FI01546.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Osi9-PA 233 CG15592-PA 1..233 67..299 1158 100 Plus
Osi7-PA 288 CG1153-PA 5..263 65..296 304 34.4 Plus
Osi12-PA 295 CG1154-PA 4..219 60..260 289 34.2 Plus
Osi14-PA 268 CG1155-PA 3..267 67..299 270 29.5 Plus
Osi11-PA 302 CG15596-PA 76..253 127..281 220 34.1 Plus

FI01546.pep Sequence

Translation from 197 to 898

> FI01546.pep
MFKFVCLFALIASTAAATSEADSLLTSALKMVKDCGERSMVLCMKERALH
YFDAENGDVRLTEGIALVKTDEIPVGRSLNEMQLPEEVEAREAEVDSLLV
ERVARFFGTHTLQFKVPKDSIQDMQRALEESRGKKKEKKKYLMPLLMLFK
LKMAALLPLAIGFLALISFKALVIGKIALLLSGIIGLKKLLESKKENYEV
VAHPHYEHEHSYGRSLPSDDSQAQQLAYAAYKQ*

FI01546.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16381-PA 232 GF16381-PA 1..232 1..233 987 96.1 Plus
Dana\GF16386-PA 267 GF16386-PA 3..266 1..233 276 29.9 Plus
Dana\GF18624-PA 305 GF18624-PA 79..256 61..215 227 35.6 Plus
Dana\GF16383-PA 295 GF16383-PA 47..215 29..191 214 36 Plus
Dana\GF16391-PA 307 GF16391-PA 7..221 2..206 196 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13161-PA 233 GG13161-PA 1..233 1..233 1212 99.6 Plus
Dere\GG13215-PA 268 GG13215-PA 3..267 1..233 295 31.3 Plus
Dere\GG13181-PA 295 GG13181-PA 49..216 29..191 221 38 Plus
Dere\GG10544-PA 302 GG10544-PA 76..253 61..215 214 35.2 Plus
Dere\GG13151-PA 288 GG13151-PA 8..231 2..202 190 35 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14025-PA 231 GH14025-PA 1..231 1..233 1027 91 Plus
Dgri\GH14030-PA 270 GH14030-PA 3..206 1..191 249 30.4 Plus
Dgri\GH14027-PA 306 GH14027-PA 36..217 15..191 220 33.5 Plus
Dgri\GH14023-PA 291 GH14023-PA 7..233 1..202 194 35.3 Plus
Dgri\GH14282-PA 326 GH14282-PA 81..264 61..215 192 35.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Osi9-PA 233 CG15592-PA 1..233 1..233 1158 100 Plus
Osi7-PA 288 CG1153-PA 8..263 2..230 303 34.8 Plus
Osi12-PA 295 CG1154-PA 49..219 29..194 276 38.5 Plus
Osi14-PA 268 CG1155-PA 3..267 1..233 270 29.5 Plus
Osi11-PA 302 CG15596-PA 76..253 61..215 220 34.1 Plus
Osi18-PA 306 CG1169-PA 7..220 6..206 213 29 Plus
Osi8-PA 274 CG15591-PA 58..240 25..201 211 29.8 Plus
Osi20-PA 280 CG15188-PA 8..185 1..181 175 23.9 Plus
Osi21-PA 282 CG14925-PA 56..236 30..205 164 29.5 Plus
Osi16-PA 278 CG31561-PA 15..232 1..212 163 26.9 Plus
Osi15-PA 214 CG1157-PA 4..172 3..197 155 30.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24397-PA 232 GI24397-PA 1..232 1..233 987 90.1 Plus
Dmoj\GI24403-PA 272 GI24403-PA 30..262 20..230 267 29.8 Plus
Dmoj\GI24400-PA 289 GI24400-PA 33..219 13..194 234 35.8 Plus
Dmoj\GI23173-PA 316 GI23173-PA 75..258 61..215 220 35.7 Plus
Dmoj\GI24395-PA 288 GI24395-PA 7..231 1..202 196 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24061-PA 232 GL24061-PA 1..232 1..233 1023 94 Plus
Dper\GL24067-PA 269 GL24067-PA 3..268 1..233 265 28.6 Plus
Dper\GL24063-PA 307 GL24063-PA 34..220 10..191 225 36.6 Plus
Dper\GL23479-PA 317 GL23479-PA 123..264 95..215 209 37.8 Plus
Dper\GL24059-PA 287 GL24059-PA 7..230 1..201 188 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13834-PA 232 GA13834-PA 1..232 1..233 1026 94.4 Plus
Dpse\GA11061-PA 269 GA11061-PA 3..268 1..233 267 28.6 Plus
Dpse\GA11059-PA 310 GA11059-PA 55..223 29..191 225 38.4 Plus
Dpse\GA11054-PA 287 GA11054-PA 7..230 1..201 188 34.2 Plus
Dpse\GA13838-PA 317 GA13838-PA 123..264 95..215 180 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10870-PA 233 GM10870-PA 1..233 1..233 1212 99.6 Plus
Dsec\GM10875-PA 268 GM10875-PA 3..267 1..233 274 30.2 Plus
Dsec\GM10872-PA 295 GM10872-PA 49..216 29..191 228 39.2 Plus
Dsec\GM10562-PA 302 GM10562-PA 76..253 61..215 209 36.1 Plus
Dsec\GM10868-PA 275 GM10868-PA 8..218 2..202 199 36.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19850-PA 233 GD19850-PA 1..233 1..233 1212 99.6 Plus
Dsim\GD19857-PA 268 GD19857-PA 3..267 1..233 293 31 Plus
Dsim\GD19852-PA 295 GD19852-PA 49..216 29..191 228 39.2 Plus
Dsim\GD19553-PA 302 GD19553-PA 76..253 61..215 211 35.2 Plus
Dsim\GD19861-PA 298 GD19861-PA 36..217 28..206 164 30.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14255-PA 231 GJ14255-PA 1..231 1..233 1003 92.7 Plus
Dvir\GJ14261-PA 277 GJ14261-PA 3..265 1..230 271 28.7 Plus
Dvir\GJ14258-PA 296 GJ14258-PA 43..210 29..191 224 36.8 Plus
Dvir\GJ14489-PA 321 GJ14489-PA 80..260 61..215 214 35.2 Plus
Dvir\GJ14251-PA 288 GJ14251-PA 7..231 1..202 194 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13040-PA 601 GK13040-PA 1..188 1..191 659 74.9 Plus
Dwil\GK18622-PA 388 GK18622-PA 160..342 43..226 506 60.4 Plus
Dwil\GK24013-PA 108 GK24013-PA 1..108 124..233 464 93.6 Plus
Dwil\GK22855-PA 133 GK22855-PA 41..132 116..213 393 85.7 Plus
Dwil\GK17707-PA 84 GK17707-PA 1..77 40..127 289 67 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10192-PA 233 GE10192-PA 1..233 1..233 1212 99.6 Plus
Dyak\GE10198-PA 268 GE10198-PA 3..267 1..233 294 31.3 Plus
Dyak\GE10195-PA 298 GE10195-PA 11..218 1..191 226 34.6 Plus
Dyak\GE24110-PA 302 GE24110-PA 76..253 61..215 212 35.2 Plus
Dyak\GE10190-PA 288 GE10190-PA 8..231 2..202 190 35 Plus