Clone FI01556 Report

Search the DGRC for FI01556

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:15
Well:56
Vector:pFlc-1
Associated Gene/TranscriptCG16704-RA
Protein status:FI01556.pep: gold
Sequenced Size:352

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16704 2008-04-29 Release 5.5 accounting
CG16704 2008-08-15 Release 5.9 accounting
CG16704 2008-12-18 5.12 accounting

Clone Sequence Records

FI01556.complete Sequence

352 bp assembled on 2007-09-04

GenBank Submission: BT030795

> FI01556.complete
GAACAGTTCGGTTTGAGATTTCAGTAAAGCAAGCCCAAGCAAAATCAATA
TGAAATACCTAGTCGTTTTTGCACTCATCTGCTGTCTTGTGGCATCAGCA
TTTGCGACTTTGAAAAACCCAATCTGTGGCGAGGAGTTTGGCGTCAAGGG
TACTTGCCGTTCCCTGCAACCCATGTGGACCTATCGCCCAGATACGAACG
AGTGCTTCACCTTCAATTACTCCGGCTGCCACGGAAACAATAATCTATTC
CACAAAAAGTTGGAGTGCGAAGAAAAATGCAAAATATAAGTGCCCATTTG
GTTGTGAATAAAGTTGGAAGTTCGGTTTTGTTATCCTAAAAAAAAAAAAA
AA

FI01556.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG16704-RA 435 CG16704-RA 76..413 2..339 1690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3691662..3691879 337..120 1075 99.5 Minus
chr2L 23010047 chr2L 3691995..3692112 119..2 590 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3692136..3692355 339..120 1100 100 Minus
2L 23513712 2L 3692471..3692588 119..2 590 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3692136..3692355 339..120 1100 100 Minus
2L 23513712 2L 3692471..3692588 119..2 590 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:36:35 has no hits.

FI01556.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:37:24 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3691662..3691879 120..337 99 <- Minus
chr2L 3691995..3692112 1..119 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:19 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..240 50..289 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:40 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..240 50..289 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:43:40 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..240 50..289 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:07 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..240 50..289 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:42:24 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..240 50..289 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:03 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..336 2..337 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:40 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..336 2..337 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:43:40 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..335 3..337 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:07 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..336 2..337 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:42:24 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 1..335 3..337 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:24 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692138..3692355 120..337 100 <- Minus
2L 3692471..3692588 1..119 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:24 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692138..3692355 120..337 100 <- Minus
2L 3692471..3692588 1..119 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:24 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692138..3692355 120..337 100 <- Minus
2L 3692471..3692588 1..119 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:40 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3692138..3692355 120..337 100 <- Minus
arm_2L 3692471..3692588 1..119 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:27 Download gff for FI01556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692138..3692355 120..337 100 <- Minus
2L 3692471..3692588 1..119 99   Minus

FI01556.hyp Sequence

Translation from 49 to 288

> FI01556.hyp
MKYLVVFALICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTN
ECFTFNYSGCHGNNNLFHKKLECEEKCKI*

FI01556.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG16704-PB 79 CG16704-PB 1..79 1..79 448 100 Plus
CG16704-PA 79 CG16704-PA 1..79 1..79 448 100 Plus
CG16713-PA 82 CG16713-PA 1..80 1..77 169 43.2 Plus
CG16712-PB 82 CG16712-PB 1..81 1..78 166 42.7 Plus
CG16712-PA 82 CG16712-PA 1..81 1..78 166 42.7 Plus

FI01556.pep Sequence

Translation from 49 to 288

> FI01556.pep
MKYLVVFALICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTN
ECFTFNYSGCHGNNNLFHKKLECEEKCKI*

FI01556.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19683-PA 79 GF19683-PA 1..78 1..78 245 56.4 Plus
Dana\GF14657-PA 82 GF14657-PA 1..78 1..78 217 47.4 Plus
Dana\GF14654-PA 82 GF14654-PA 1..81 1..78 130 39 Plus
Dana\GF15247-PA 82 GF15247-PA 20..81 21..78 130 45.2 Plus
Dana\GF14655-PA 81 GF14655-PA 4..79 9..77 129 39.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24419-PA 79 GG24419-PA 1..79 1..79 329 75.9 Plus
Dere\GG24411-PA 78 GG24411-PA 1..76 1..77 166 45.5 Plus
Dere\GG24417-PA 78 GG24417-PA 1..76 1..77 162 45.5 Plus
Dere\GG24415-PA 82 GG24415-PA 1..80 1..77 148 40.7 Plus
Dere\GG24416-PA 78 GG24416-PA 1..76 1..77 148 40.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13185-PA 79 GH13185-PA 1..79 1..79 256 64.6 Plus
Dgri\GH22483-PA 79 GH22483-PA 1..79 1..79 256 64.6 Plus
Dgri\GH25267-PA 79 GH25267-PA 1..79 1..79 243 60.8 Plus
Dgri\GH13183-PA 79 GH13183-PA 1..79 1..79 243 60.8 Plus
Dgri\GH22481-PA 83 GH22481-PA 1..81 1..77 147 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG16704-PB 79 CG16704-PB 1..79 1..79 448 100 Plus
CG16704-PA 79 CG16704-PA 1..79 1..79 448 100 Plus
CG16713-PA 82 CG16713-PA 1..80 1..77 169 43.2 Plus
IM33-PB 82 CG16712-PB 1..81 1..78 166 42.7 Plus
IM33-PA 82 CG16712-PA 1..81 1..78 166 42.7 Plus
Acp24A4-PC 78 CG31779-PC 1..76 1..77 157 40.3 Plus
Acp24A4-PB 78 CG31779-PB 1..76 1..77 157 40.3 Plus
CG42460-PB 79 CG42460-PB 10..77 6..78 134 37 Plus
CG42460-PA 79 CG42460-PA 10..77 6..78 134 37 Plus
CG43165-PA 95 CG43165-PA 3..82 4..79 133 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17763-PA 79 GI17763-PA 1..79 1..79 270 64.6 Plus
Dmoj\GI17761-PA 64 GI17761-PA 1..64 16..79 252 71.9 Plus
Dmoj\GI17760-PA 79 GI17760-PA 1..79 1..79 240 67.1 Plus
Dmoj\GI17758-PA 82 GI17758-PA 1..80 1..77 143 40.7 Plus
Dmoj\GI23877-PA 82 GI23877-PA 1..81 4..78 132 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19465-PA 79 GL19465-PA 1..79 1..79 234 60.8 Plus
Dper\GL19463-PA 79 GL19463-PA 1..79 1..79 227 60.8 Plus
Dper\GL19459-PA 82 GL19459-PA 1..81 1..78 185 46.3 Plus
Dper\GL19427-PA 78 GL19427-PA 1..77 1..78 178 43.6 Plus
Dper\GL18565-PA 79 GL18565-PA 1..75 1..77 139 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25973-PA 79 GA25973-PA 1..79 1..79 238 62 Plus
Dpse\GA25972-PA 79 GA25972-PA 1..79 1..79 227 60.8 Plus
Dpse\GA14098-PA 82 GA14098-PA 1..81 1..78 195 48.8 Plus
Dpse\GA25956-PA 78 GA25956-PA 1..77 1..78 173 43.6 Plus
Dpse\GA25689-PA 79 GA25689-PA 1..75 1..77 140 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18131-PA 78 GM18131-PA 1..78 1..79 370 88.6 Plus
Dsec\GM18127-PA 82 GM18127-PA 1..81 1..78 161 42.7 Plus
Dsec\GM18128-PA 82 GM18128-PA 1..80 1..77 152 42 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22738-PA 86 GD22738-PA 1..79 1..79 333 77.2 Plus
Dsim\GD22734-PA 82 GD22734-PA 1..81 1..78 160 42.7 Plus
Dsim\GD22735-PA 82 GD22735-PA 1..80 1..77 152 42 Plus
Dsim\Acp24A4-PA 78 GD22736-PA 1..76 1..77 137 39 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16350-PA 79 GJ16350-PA 1..79 1..79 211 59.5 Plus
Dvir\GJ17586-PA 82 GJ17586-PA 1..80 1..77 140 35.8 Plus
Dvir\GJ21125-PA 80 GJ21125-PA 1..78 1..77 127 38 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15472-PA 79 GK15472-PA 1..79 1..79 302 69.6 Plus
Dwil\GK18965-PA 79 GK18965-PA 1..79 1..79 204 41.8 Plus
Dwil\GK15469-PA 80 GK15469-PA 1..78 1..77 135 39.5 Plus
Dwil\GK15471-PA 90 GK15471-PA 1..89 1..78 129 32.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14820-PA 83 GE14820-PA 1..79 1..79 309 70.9 Plus
Dyak\GE14816-PA 82 GE14816-PA 1..80 1..77 148 40.7 Plus
Dyak\GE14815-PA 82 GE14815-PA 21..81 22..78 127 42.6 Plus