Clone FI01566 Report

Search the DGRC for FI01566

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:15
Well:66
Vector:pFlc-1
Associated Gene/TranscriptSgf29-RA
Protein status:FI01566.pep: gold
Sequenced Size:1080

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30390 2008-04-29 Release 5.5 accounting
CG30390 2008-08-15 Release 5.9 accounting
CG30390 2008-12-18 5.12 accounting

Clone Sequence Records

FI01566.complete Sequence

1080 bp assembled on 2007-09-05

GenBank Submission: BT030796

> FI01566.complete
GATAGTTAATACTAACGCGTTGTCGACTTTACGCTTATGCTTGTTTTTGT
TTTCATTGCGTAGGTAAACAAAGTGTTCAAAAAACAAATTTATTATATTG
TTATAATATCGAAACAACATGCCACTGACTGCGGAGAGTGCCGCCCAACA
GATTCAGGATCGCCTGAAGGACATTCAACAAAACATTCACAATGTGGACG
AGGAGCGTCGTCGTGCGGAAAACTCCATTGCTAGTCTGGTGCGATCTCTG
CACGCCACCAATCAGAAGGTTAAGCCCCTGCTCAAGGCCAGTTTAACGGA
GGCTGCGCAGGAGGAGGCCACAATCCGAGCCGCACTGGCGAAAATCCACG
AGATTCGAAGCATTCGCAATGAGAGGCGCATCCAAGCTCGCAACGCTGGA
AATAAGGAGGCCATTCGACGGGGCGCCCTTATGAAAATGGTGCAGCTCTC
AGCGCAAACGTTGCCGTTATTCGTTGGCAAACTAGGAGAACGAGCACCAG
CTCTATGTGGAGCCATTCCCGCCGAGGGGAACTATGTGGCCAAGGTTGGC
GACAATGTTGCCGCATTAGCTAAGGGAATTGATGAGGAGGAGAACTGGAT
CCTGGCGGAAGTGGTGCAGTTCCTTCACCGTCAAAACAAATACGACGTAA
TTGACATTGACGAGGAGCAAAAGGATCGCCATGTGCTGAGCAAGCGAAAG
GTCATCCCACTGCCTCTAATGCGTGCAAATCCTGAGACCGATGGTCACGC
CCTCTTCCCCAAGGACACAGTGGTAATGGCGCTATATCCACAGACCACCT
GTTTCTACAAGGCCATTGTCCATCGCCTGCCGCAAACCGCCACCGAGGAT
TACGAGGTGCTATTCGAGGATTCATCGTACACGAATGGCTATGCCGAACC
CTTGCCGGTCGCACAGCGCTATGTGATTGCATATCGTCCAACGAAAAAGG
GGGCTGGCAGTGGCAGCGGGAATCTATCATCAGCATAAAAAATGTATTAT
CTTAACTTTAAGAATTAAATGTAATTGTAATAATAGCTCCAATTAAAATT
GTATTCAATTCACGAAAAAAAAAAAAAAAA

FI01566.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG30390-RA 1065 CG30390-RA 1..1062 2..1063 5310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17178718..17179238 1063..543 2560 99.4 Minus
chr2R 21145070 chr2R 17179516..17179747 386..155 1085 97.8 Minus
chr2R 21145070 chr2R 17179799..17179955 158..2 785 100 Minus
chr2R 21145070 chr2R 17179304..17179465 546..385 780 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21292239..21292759 1063..543 2605 100 Minus
2R 25286936 2R 21293037..21293268 386..155 1160 100 Minus
2R 25286936 2R 21292825..21292986 546..385 810 100 Minus
2R 25286936 2R 21293320..21293476 158..2 785 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21293438..21293958 1063..543 2605 100 Minus
2R 25260384 2R 21294236..21294467 386..155 1160 100 Minus
2R 25260384 2R 21294024..21294185 546..385 810 100 Minus
2R 25260384 2R 21294519..21294675 158..2 785 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:36:48 has no hits.

FI01566.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:38:08 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17178717..17179236 545..1064 99 <- Minus
chr2R 17179306..17179463 387..544 98 <- Minus
chr2R 17179516..17179744 158..386 97 <- Minus
chr2R 17179800..17179955 1..157 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:21 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
CG30390-RA 1..870 119..988 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:23:12 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf29-RA 1..870 119..988 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:55:51 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf29-RA 1..870 119..988 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:40 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
CG30390-RA 1..870 119..988 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:44:24 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf29-RA 1..870 119..988 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:39:43 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
CG30390-RA 1..987 2..988 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:23:11 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf29-RA 1..1062 2..1063 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:55:51 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf29-RA 1..1027 37..1063 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:40 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
CG30390-RA 1..987 2..988 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:44:24 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
Sgf29-RA 1..1027 37..1063 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:08 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21293321..21293476 1..157 99   Minus
2R 21292238..21292757 545..1064 99 <- Minus
2R 21292827..21292984 387..544 100 <- Minus
2R 21293037..21293265 158..386 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:08 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21293321..21293476 1..157 99   Minus
2R 21292238..21292757 545..1064 99 <- Minus
2R 21292827..21292984 387..544 100 <- Minus
2R 21293037..21293265 158..386 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:08 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21293321..21293476 1..157 99   Minus
2R 21292238..21292757 545..1064 99 <- Minus
2R 21292827..21292984 387..544 100 <- Minus
2R 21293037..21293265 158..386 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:55:51 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17179743..17180262 545..1064 99 <- Minus
arm_2R 17180332..17180489 387..544 100 <- Minus
arm_2R 17180542..17180770 158..386 100 <- Minus
arm_2R 17180826..17180981 1..157 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:55:02 Download gff for FI01566.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21293437..21293956 545..1064 99 <- Minus
2R 21294026..21294183 387..544 100 <- Minus
2R 21294236..21294464 158..386 100 <- Minus
2R 21294520..21294675 1..157 99   Minus

FI01566.pep Sequence

Translation from 118 to 987

> FI01566.pep
MPLTAESAAQQIQDRLKDIQQNIHNVDEERRRAENSIASLVRSLHATNQK
VKPLLKASLTEAAQEEATIRAALAKIHEIRSIRNERRIQARNAGNKEAIR
RGALMKMVQLSAQTLPLFVGKLGERAPALCGAIPAEGNYVAKVGDNVAAL
AKGIDEEENWILAEVVQFLHRQNKYDVIDIDEEQKDRHVLSKRKVIPLPL
MRANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLPQTATEDYEVLFE
DSSYTNGYAEPLPVAQRYVIAYRPTKKGAGSGSGNLSSA*

FI01566.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12107-PA 289 GF12107-PA 1..289 1..289 1498 97.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20786-PA 289 GG20786-PA 1..289 1..289 1508 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21249-PA 291 GH21249-PA 1..291 1..289 1382 90 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Sgf29-PB 289 CG30390-PB 1..289 1..289 1458 100 Plus
Sgf29-PA 289 CG30390-PA 1..289 1..289 1458 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20536-PA 289 GI20536-PA 1..289 1..289 1398 91.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10755-PA 251 GL10755-PA 1..251 1..289 1208 81.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15811-PA 289 GA15811-PA 1..289 1..289 1442 93.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15731-PA 289 GM15731-PA 1..289 1..289 1508 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25209-PA 289 GD25209-PA 1..289 1..289 1508 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22385-PA 291 GJ22385-PA 1..291 1..289 1403 91.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21485-PA 291 GK21485-PA 1..291 1..289 1335 89.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13723-PA 289 GE13723-PA 1..289 1..289 1509 98.6 Plus

FI01566.hyp Sequence

Translation from 118 to 987

> FI01566.hyp
MPLTAESAAQQIQDRLKDIQQNIHNVDEERRRAENSIASLVRSLHATNQK
VKPLLKASLTEAAQEEATIRAALAKIHEIRSIRNERRIQARNAGNKEAIR
RGALMKMVQLSAQTLPLFVGKLGERAPALCGAIPAEGNYVAKVGDNVAAL
AKGIDEEENWILAEVVQFLHRQNKYDVIDIDEEQKDRHVLSKRKVIPLPL
MRANPETDGHALFPKDTVVMALYPQTTCFYKAIVHRLPQTATEDYEVLFE
DSSYTNGYAEPLPVAQRYVIAYRPTKKGAGSGSGNLSSA*

FI01566.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Sgf29-PB 289 CG30390-PB 1..289 1..289 1458 100 Plus
Sgf29-PA 289 CG30390-PA 1..289 1..289 1458 100 Plus