Clone FI01641 Report

Search the DGRC for FI01641

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:16
Well:41
Vector:pFlc-1
Associated Gene/TranscriptCG13297-RA
Protein status:FI01641.pep: gold
Sequenced Size:609

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13297 2008-04-29 Release 5.5 accounting
CG13297 2008-08-15 Release 5.9 accounting
CG13297 2008-12-18 5.12 accounting

Clone Sequence Records

FI01641.complete Sequence

609 bp assembled on 2007-09-04

GenBank Submission: BT030797

> FI01641.complete
ATTAAGCTCCCAGCCGCCTTGGTTGCATGTTGTGTTTTTACAGATCCAAT
ATGAGTCTATCCTCGGTGCCAAGCAGCATTCAGCATGGGAACAAGGTAAC
GCGCTGTGGCCTGAGCATCAACAATAAACTAGTGCAGGCCCTGATCCTCC
TTTTGGCCTGCATTCTCTTTGGTGCCAACATGAACTACGCCTCCTTTCCA
CCTGGCACTGTCATCGATATCAAGCTGGGAGATGTCGCCCTCGAGCAGTT
CAGCTATACGCCAACCCGCGATGGATACGAGTTCAACTACACTCTTCCTG
ATGGAACTTTTCGTGATGAGGTTGGCAAGGTCCTGAGTGGAACTTCAGCT
GCCCAGGATCTGGAAAATGCCAACAACTTGGCCAAGAACCACCGTCCCTC
GCGTCAACAGGGCCTTAAGGTTCGCAAGTTGTCCGGAAAATCTCTTGCAT
CTCTGGCCGGATAAGACACCTCAGAAAACATTATTATTTACAATCCAGCA
CGAATTTATTTAAACAGTTTGCATTGCCGACTGTTTTAGGCTAGCTTATA
AGTTGAGATGTTACATTTGTTAGCAATAAAAACAATCGATCGAAAAAAAA
AAAAAAAAA

FI01641.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13297.a 1086 CG13297.a 346..936 1..591 2955 100 Plus
CG13297-RA 770 CG13297-RA 30..620 1..591 2955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6149142..6149452 591..281 1480 98.4 Minus
chr3L 24539361 chr3L 6149645..6149930 286..1 1325 97.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6156592..6156902 591..281 1540 99.7 Minus
3L 28110227 3L 6157088..6157373 286..1 1430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6149692..6150002 591..281 1540 99.6 Minus
3L 28103327 3L 6150188..6150473 286..1 1430 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:15:58 has no hits.

FI01641.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:16:55 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6149141..6149446 287..592 98 <- Minus
chr3L 6149645..6149930 1..286 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:22 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..438 27..464 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:41 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..438 27..464 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:34:59 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..438 27..464 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:09 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..438 27..464 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:17:10 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..438 27..464 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:06 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:41 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:34:59 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 5..595 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:09 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:10 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
CG13297-RA 5..595 1..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:55 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6156591..6156896 287..592 99 <- Minus
3L 6157088..6157373 1..286 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:55 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6156591..6156896 287..592 99 <- Minus
3L 6157088..6157373 1..286 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:16:55 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6156591..6156896 287..592 99 <- Minus
3L 6157088..6157373 1..286 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:34:59 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6149691..6149996 287..592 99 <- Minus
arm_3L 6150188..6150473 1..286 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:28 Download gff for FI01641.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6149691..6149996 287..592 99 <- Minus
3L 6150188..6150473 1..286 100   Minus

FI01641.pep Sequence

Translation from 26 to 463

> FI01641.pep
MLCFYRSNMSLSSVPSSIQHGNKVTRCGLSINNKLVQALILLLACILFGA
NMNYASFPPGTVIDIKLGDVALEQFSYTPTRDGYEFNYTLPDGTFRDEVG
KVLSGTSAAQDLENANNLAKNHRPSRQQGLKVRKLSGKSLASLAG*

FI01641.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10916-PA 138 GF10916-PA 10..138 17..145 554 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14077-PA 137 GG14077-PA 1..137 9..145 616 83.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15645-PA 123 GH15645-PA 20..123 39..145 327 59.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13297-PA 145 CG13297-PA 1..145 1..145 741 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12692-PA 120 GI12692-PA 30..120 55..145 285 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15512-PA 177 GL15512-PA 49..177 12..145 446 65.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23847-PA 177 GA23847-PA 47..177 14..145 425 70.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13860-PA 137 GM13860-PA 1..137 9..145 691 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13143-PA 137 GD13143-PA 1..137 9..145 695 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12676-PA 116 GJ12676-PA 23..116 49..145 327 64.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16912-PA 143 GK16912-PA 29..143 31..145 429 70.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20501-PA 137 GE20501-PA 1..137 9..145 663 90.5 Plus

FI01641.hyp Sequence

Translation from 26 to 463

> FI01641.hyp
MLCFYRSNMSLSSVPSSIQHGNKVTRCGLSINNKLVQALILLLACILFGA
NMNYASFPPGTVIDIKLGDVALEQFSYTPTRDGYEFNYTLPDGTFRDEVG
KVLSGTSAAQDLENANNLAKNHRPSRQQGLKVRKLSGKSLASLAG*

FI01641.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13297-PA 145 CG13297-PA 1..145 1..145 741 100 Plus