Clone FI01658 Report

Search the DGRC for FI01658

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:16
Well:58
Vector:pFlc-1
Associated Gene/TranscriptRpL23A-RA
Protein status:FI01658.pep: gold
Sequenced Size:1054

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL23A 2008-04-29 Release 5.5 accounting
RpL23A 2008-08-15 Release 5.9 accounting
RpL23A 2008-12-18 5.12 accounting

Clone Sequence Records

FI01658.complete Sequence

1054 bp assembled on 2007-09-04

GenBank Submission: BT030798

> FI01658.complete
GCTTTTGACAACTGCCCCTCAGTTTTCCTTTTCATTTCTTTTTCTCGTAG
AAATGCCACCCAAAAAGCCAACCGAGAAATCCGCCAAGCCTGGCGACAAG
AAGCCAGAGCAGAAGAAGACTGCTGCGGCTCCCGCTGCCGGCAAGAAGGA
GGCTGCTCCCTCGGCTGCCAAGCCAGCTGCCGCTGCGCCCAAGAAGGCTG
CTGCCCCAGCGGCTAAGAAGGCTGCTCCGGCCGCCAAGAAGCCAGCGACC
GCCGGTGCTGCTGCCAAGAAGCCCGCGGCCGTAAAGACGACCGCGGCCGC
CAAGGCCAAGAGCAAGGATGCCAAGAAGAAGGTCCTCGCCGGCAAGAAGC
CCCAGTCCGTGCTGGCCAAGCTCTCTGCCAAGGCTCGCGCGGCCGCCAAG
GCCAAGAAGGGCGTGAAGCCCGTGACCAAGCCCGCCAAGGGAACCGCCAA
GGCCAAGGCTGTGGCTCTGCTGAACGCCAAGAAGGTCCAGAAGAAGATCA
TCAAGGGCGCCTTCGGCACCCGTGCCCGCAAGATCCGCACCAACGTGCAC
TTCCGTCGGCCAACCACCCTGAAGCTGCCCAGGAGTCCCAAGTACCCCAG
GAAATCGGTGCCCACCAGGAACCGCATGGACGCGTACAACATCATCAAGT
ACCCACTGACCACCGAGGCGGCCATGAAGAAGATCGAGGACAACAACACC
CTGGTCTTCCTCACACACCTGCGCGCCAACAAGAACCACGTGCGTGCCGC
AGTGCGCAAGCTCTACGACATCAAGGTGGCCAAGGTGAACGTGCTCATCC
GGCCCGATGGCCAGAAGAAGGCCTATGTGCGCCTGGCGCGCGACTACGAC
GCCCTGGACATTGCCAACAAGATCGGCATCATATAAGCGCTGCAATCTGC
GGTAACGTGTGGAATGGGCATCGCGTTCTACATTTTATATGTAGATTCTT
TTCTATAAACAAAGTAATGCTAAGCTGACACGGTAGAGCGAGGATGAACG
TTTCAAAGTTGTCTGGGTTTAATAAAACCACTCAAAAACTAAAAAAAAAA
AAAA

FI01658.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
RpL23A-RA 1207 RpL23A-RA 71..1111 2..1042 5205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1666740..1667285 1040..495 2715 99.8 Minus
chr3L 24539361 chr3L 1667357..1667770 496..83 2070 100 Minus
chr3L 24539361 chr3L 1668144..1668225 83..2 410 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 16:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Uhg7-RA 421 CR42453-RA 1..118 925..1042 590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1667190..1667737 1042..495 2740 100 Minus
3L 28110227 3L 1667809..1668222 496..83 2070 100 Minus
3L 28110227 3L 1668596..1668677 83..2 410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1667190..1667737 1042..495 2740 100 Minus
3L 28103327 3L 1667809..1668222 496..83 2070 100 Minus
3L 28103327 3L 1668596..1668677 83..2 410 100 Minus
Blast to na_te.dros performed 2019-03-15 16:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 650..750 152..258 126 59.8 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 647..753 197..303 112 56.1 Plus
rooA 7621 rooA ROOA_LTR 7621bp 6504..6554 920..970 111 68.6 Plus
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 4486..4537 78..130 109 69.8 Plus

FI01658.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:30:03 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1666740..1667283 497..1040 99 <- Minus
chr3L 1667357..1667769 84..496 100 <- Minus
chr3L 1668144..1668225 1..83 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:23 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..834 53..886 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:42 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..834 53..886 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:15:42 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..834 53..886 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:10 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..834 53..886 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:11 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..834 53..886 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 16:06:43 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
Uhg7-RA 1..116 925..1040 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:10 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..1039 2..1040 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:42 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..1039 2..1040 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:15:42 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 22..1016 46..1040 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:10 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 1..1039 2..1040 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:11 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
RpL23A-RA 22..1016 46..1040 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:03 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1667192..1667735 497..1040 100 <- Minus
3L 1667809..1668221 84..496 100 <- Minus
3L 1668596..1668677 1..83 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:03 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1667192..1667735 497..1040 100 <- Minus
3L 1667809..1668221 84..496 100 <- Minus
3L 1668596..1668677 1..83 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:30:03 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1667192..1667735 497..1040 100 <- Minus
3L 1667809..1668221 84..496 100 <- Minus
3L 1668596..1668677 1..83 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:15:42 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1667192..1667735 497..1040 100 <- Minus
arm_3L 1667809..1668221 84..496 100 <- Minus
arm_3L 1668596..1668677 1..83 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:29 Download gff for FI01658.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1667192..1667735 497..1040 100 <- Minus
3L 1667809..1668221 84..496 100 <- Minus
3L 1668596..1668677 1..83 98   Minus

FI01658.hyp Sequence

Translation from 1 to 885

> FI01658.hyp
LLTTAPQFSFSFLFLVEMPPKKPTEKSAKPGDKKPEQKKTAAAPAAGKKE
AAPSAAKPAAAAPKKAAAPAAKKAAPAAKKPATAGAAAKKPAAVKTTAAA
KAKSKDAKKKVLAGKKPQSVLAKLSAKARAAAKAKKGVKPVTKPAKGTAK
AKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPR
KSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAA
VRKLYDIKVAKVNVLIRPDGQKKAYVRLARDYDALDIANKIGII*

FI01658.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpL23A-PA 277 CG7977-PA 1..277 18..294 1372 100 Plus
RpL22-PA 299 CG7434-PA 3..189 19..178 180 38 Plus
RpL22-PA 299 CG7434-PA 64..241 22..192 157 36.2 Plus

FI01658.pep Sequence

Translation from 52 to 885

> FI01658.pep
MPPKKPTEKSAKPGDKKPEQKKTAAAPAAGKKEAAPSAAKPAAAAPKKAA
APAAKKAAPAAKKPATAGAAAKKPAAVKTTAAAKAKSKDAKKKVLAGKKP
QSVLAKLSAKARAAAKAKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKII
KGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKY
PLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIR
PDGQKKAYVRLARDYDALDIANKIGII*

FI01658.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24974-PA 534 GF24974-PA 357..534 100..277 814 96.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14575-PA 76 GG14575-PA 1..36 1..36 146 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15515-PA 280 GH15515-PA 102..280 100..277 791 89.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpL23A-PA 277 CG7977-PA 1..277 1..277 1372 100 Plus
RpL22-PA 299 CG7434-PA 3..189 2..161 180 38 Plus
RpL22-PA 299 CG7434-PA 64..241 5..175 157 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16793-PA 274 GI16793-PA 90..274 94..277 852 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12432-PA 266 GL12432-PA 1..266 1..277 835 78.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20736-PA 266 GA20736-PA 1..266 1..277 843 78.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14186-PA 70 GM14186-PA 1..70 208..277 369 100 Plus
Dsec\GM14185-PA 139 GM14185-PA 1..133 1..133 192 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13453-PA 277 GD13453-PA 1..277 1..277 1299 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12535-PA 276 GJ12535-PA 98..276 100..277 779 94.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17068-PA 273 GK17068-PA 1..273 1..277 827 78.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL23A-PA 277 GE20933-PA 1..277 1..277 1287 97.1 Plus