Clone FI01736 Report

Search the DGRC for FI01736

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:17
Well:36
Vector:pFlc-1
Associated Gene/TranscriptmRpL30-RA
Protein status:FI01736.pep: gold
Sequenced Size:706

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL30 2008-04-29 Release 5.5 accounting
mRpL30 2008-08-15 Release 5.9 accounting
mRpL30 2008-12-18 5.12 accounting

Clone Sequence Records

FI01736.complete Sequence

706 bp assembled on 2007-09-04

GenBank Submission: BT030799

> FI01736.complete
GTCTGTGTAATCGTTATCGTCGGGGAAACATCAATTATTTCATAAGCGTT
TTGCATTTAATTTTATTACAAAGGGGGGAAAACAATTAAGATGAACCTGG
GAAGGCTGCTGAATCCACTGAGGAGCACCGCATGTTCGGTGCGCAGCTAC
GGAAAGCACAACAAGAAGTTCCTCTACAAAAATGGCCAGAAATTTGAGGG
TATCACCTACTATCCCAGGACTCCCGATCACCAGGATCCACCCGTGGAGC
CGGCGAAACTTTTCCGGGTGCAGCGCATCAAGCCGCTAAAGGGCAATCCC
TACTGGGAGAATCGAATCCTCAAAGATCTGGGACTAGACGGAAAGCAGAG
CGATTTTACTGTCGTCAAGAACATACCGGAGAACAATGCCCGCCTGTGGA
AGATCAAGCATCTAATTAAGGTTACGCCGGTCACGTTCCCCTACGGAGAG
CCCACTGCCCAGGATGTCCGGCATACGATACTCAAGGAGAACGGCGAGTG
CCTGGTAACCAAGGACCTGGGACCCATCGATACCCGCCTGGCGGCTCGCC
AGGATTACGACGAGCAGCCCAAGCGACTGGATACCGATCTGCTGCGCAAA
GATGCCCGCCTCAAGTGGCTAAATCCCTGGTAGTTAAAATTTGTTTTCTT
TATTCCGAAAAAATAGTTTTTTAAATACAAACCGAAACCCAAAAAAAAAA
AAAAAA

FI01736.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL30-RA 754 mRpL30-RA 25..717 1..693 3465 100 Plus
torp4a.a 1363 torp4a.a 1286..1363 627..550 390 100 Minus
torp4a.c 1264 torp4a.c 1205..1264 693..634 300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4540964..4541438 216..690 2375 100 Plus
chrX 22417052 chrX 4540669..4540887 1..219 1095 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4648172..4648649 216..693 2390 100 Plus
X 23542271 X 4647877..4648095 1..219 1095 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4656270..4656747 216..693 2390 100 Plus
X 23527363 X 4655975..4656193 1..219 1095 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:02:35 has no hits.

FI01736.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:03:29 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4540669..4540886 1..218 100 -> Plus
chrX 4540967..4541438 219..690 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:25 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..543 91..633 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:44 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..543 91..633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:26:40 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..543 91..633 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:11 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..543 91..633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:54:40 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..543 91..633 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:15 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..690 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:43 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..690 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:26:40 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 7..696 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:11 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 1..690 1..690 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:54:40 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL30-RA 7..696 1..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:29 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
X 4647877..4648094 1..218 100 -> Plus
X 4648175..4648646 219..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:29 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
X 4647877..4648094 1..218 100 -> Plus
X 4648175..4648646 219..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:03:29 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
X 4647877..4648094 1..218 100 -> Plus
X 4648175..4648646 219..690 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:26:40 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4541910..4542127 1..218 100 -> Plus
arm_X 4542208..4542679 219..690 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:31 Download gff for FI01736.complete
Subject Subject Range Query Range Percent Splice Strand
X 4655975..4656192 1..218 100 -> Plus
X 4656273..4656744 219..690 100   Plus

FI01736.pep Sequence

Translation from 90 to 632

> FI01736.pep
MNLGRLLNPLRSTACSVRSYGKHNKKFLYKNGQKFEGITYYPRTPDHQDP
PVEPAKLFRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNA
RLWKIKHLIKVTPVTFPYGEPTAQDVRHTILKENGECLVTKDLGPIDTRL
AARQDYDEQPKRLDTDLLRKDARLKWLNPW*

FI01736.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21418-PA 180 GF21418-PA 1..180 1..180 862 87.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18718-PA 180 GG18718-PA 1..180 1..180 907 95 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17885-PA 180 GH17885-PA 1..180 1..180 802 81.1 Plus
Dgri\GH17886-PA 187 GH17886-PA 29..187 22..180 654 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL30-PA 180 CG7038-PA 1..180 1..180 978 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16457-PA 180 GI16457-PA 1..180 1..180 787 80 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14759-PA 180 GL14759-PA 1..180 1..180 804 81.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20051-PA 180 GA20051-PA 1..180 1..180 804 81.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12357-PA 180 GM12357-PA 1..180 1..180 940 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16700-PA 180 GD16700-PA 1..180 1..180 940 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15858-PA 180 GJ15858-PA 1..180 1..180 793 80.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16162-PA 180 GK16162-PA 1..180 1..180 774 77.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16356-PA 180 GE16356-PA 1..180 1..180 908 95 Plus

FI01736.hyp Sequence

Translation from 90 to 632

> FI01736.hyp
MNLGRLLNPLRSTACSVRSYGKHNKKFLYKNGQKFEGITYYPRTPDHQDP
PVEPAKLFRVQRIKPLKGNPYWENRILKDLGLDGKQSDFTVVKNIPENNA
RLWKIKHLIKVTPVTFPYGEPTAQDVRHTILKENGECLVTKDLGPIDTRL
AARQDYDEQPKRLDTDLLRKDARLKWLNPW*

FI01736.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL30-PA 180 CG7038-PA 1..180 1..180 978 100 Plus