Clone FI01801 Report

Search the DGRC for FI01801

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:18
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG32027-RA
Protein status:FI01801.pep: wuzgold
Sequenced Size:1083

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32027 2008-04-29 Release 5.5 accounting
CG32027 2008-08-15 Release 5.9 accounting
CG32027 2008-12-18 5.12 accounting

Clone Sequence Records

FI01801.complete Sequence

1083 bp assembled on 2007-09-04

GenBank Submission: BT030800

> FI01801.complete
ACTTTCTTATTAGCGCTAAAATATTCCGCGACTGGGATAATTCAATTTCA
ATTGTAACAAATTTACGCCTCTTGGCCAATTATATACAGGACGGGCAGTT
TGAAGAGCCAGACCCTGAGTCGAGCCATATTGGGTCAAAGAGTTGGCGGA
CAGCGCTTAGATATACGCGTCCACAACACCAACACCGACGACTCCGATCA
ACAGCGCCACCCCCACAAACCCGTGGTCACCAATTGGAACTCCACTGCCA
CTGCCGCCGAGCCCTGGTCCTGATCGTTCACTGTTAAGTCCCGCCAACAG
CAGCTACCTGTCCACATCCACATCACCACACCCGCCACCGGACTACGACG
ACATCTTCGTTGGGTAATAAGGACTCGGATCTGGACTCCAGACCCACGAT
ACGGATGGTGGAACCGTTATATCGGCTTGGTCGTAAAGGAGGAGCAGGCA
CCAGTGCAGGAAGTGCACCTTGATGTTAAGGTCCATTAACCAAGCAAACA
TCACCATGCTGAAGTGCGCTGTTTCGAAGTGGCAGCCGATTTGATGACTA
AGATTCATCCCAATTAAACGACCTATTAAACTCAACTGTGGTGCACGGAA
CTTAAAAAATCTTAAGGAATATGATGAGGAGACGGTGTACCGTGAAAACG
GGAACTGCTGTGCCATTTAGACCAAACTGGCAACCTGTTACATATTTCAG
CCACGTTAGCCAGGCGACACCTGAAGGTAATAACGGCAGGCCACCTGTTG
CTGATCACAAAGACTACAGGAATTTGAAATTACTGACACAGTACCCAATA
CTATGCCCTTATTTATTCTTAGAACATATGTACATAAATACATTAATCGG
CATTTAATGGTATCATCAGTGTTTAAGTCCATGTTTTTGTTGATCTATTA
CATATGTATTTCTTTAATGACATAAAGAAAAAGCTAAACAATTAGAAACT
AAGCCAGAAAGTAGTTGTACAATAGTTAATTAAGGATCGTACCTTATGTT
CAGACATACTTTACTTTAATGAAATTTAATCATTCATTTTCCATATAAGT
ATAATGACTTAAGCATCAAAAAAAAAAAAAAAA

FI01801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32027-RA 1065 CG32027-RA 1..1065 1..1068 5270 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18831234..18831803 1..570 2835 99.8 Plus
chr3L 24539361 chr3L 18832000..18832441 626..1067 2135 98.9 Plus
chr3L 24539361 chr3L 18831868..18831921 570..623 270 100 Plus
chr2L 23010047 chr2L 19517142..19517206 103..39 235 90.8 Minus
chrX 22417052 chrX 6587475..6587518 35..78 190 95.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18841579..18842148 1..570 2850 100 Plus
3L 28110227 3L 18842345..18842787 626..1068 2215 100 Plus
3L 28110227 3L 18842213..18842266 570..623 270 100 Plus
X 23542271 X 6695296..6695339 35..78 190 95.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18834679..18835248 1..570 2850 100 Plus
3L 28103327 3L 18835445..18835887 626..1068 2215 100 Plus
3L 28103327 3L 18835313..18835366 570..623 270 100 Plus
X 23527363 X 6703394..6703437 35..78 190 95.4 Plus
2L 23513712 2L 19518607..19518642 74..39 165 97.2 Minus
2L 23513712 2L 19518377..19518410 364..331 155 97 Minus
2L 23513712 2L 19518425..19518467 272..230 155 90.6 Minus
Blast to na_te.dros performed 2019-03-15 23:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6826..6959 920..1053 137 60.6 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3172..3311 767..907 135 56 Plus

FI01801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:37:34 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18831234..18831803 1..570 99 -> Plus
chr3L 18831869..18831921 571..623 100 -> Plus
chr3L 18832001..18832441 624..1067 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:26 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 1..234 624..857 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:45 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 1..234 624..857 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:12 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 1..234 624..857 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:19 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 1..1064 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:45 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 1..1064 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:12 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 1..1064 1..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:34 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18841579..18842148 1..570 100 -> Plus
3L 18842214..18842266 571..623 100 -> Plus
3L 18842346..18842786 624..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:34 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18841579..18842148 1..570 100 -> Plus
3L 18842214..18842266 571..623 100 -> Plus
3L 18842346..18842786 624..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:37:34 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18841579..18842148 1..570 100 -> Plus
3L 18842214..18842266 571..623 100 -> Plus
3L 18842346..18842786 624..1067 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:47 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18834679..18835248 1..570 100 -> Plus
arm_3L 18835314..18835366 571..623 100 -> Plus
arm_3L 18835446..18835886 624..1067 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:47 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18834679..18835248 1..570 100 -> Plus
arm_3L 18835314..18835366 571..623 100 -> Plus
arm_3L 18835446..18835886 624..1067 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:47 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18834679..18835248 1..570 100 -> Plus
arm_3L 18835314..18835366 571..623 100 -> Plus
arm_3L 18835446..18835886 624..1067 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:32 Download gff for FI01801.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18834679..18835248 1..570 100 -> Plus
3L 18835314..18835366 571..623 100 -> Plus
3L 18835446..18835886 624..1067 99   Plus

FI01801.hyp Sequence

Translation from 2 to 286

> FI01801.hyp
FLISAKIFRDWDNSISIVTNLRLLANYIQDGQFEEPDPESSHIGSKSWRT
ALRYTRPQHQHRRLRSTAPPPQTRGHQLELHCHCRRALVLIVHC*
Sequence FI01801.hyp has no blast hits.

FI01801.pep Sequence

Translation from 620 to 856

> FI01801.pep
MMRRRCTVKTGTAVPFRPNWQPVTYFSHVSQATPEGNNGRPPVADHKDYR
NLKLLTQYPILCPYLFLEHMYINTLIGI*

FI01801.pep Blast Records

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14771-PA 60 GD14771-PA 7..43 12..48 165 83.8 Plus