Clone FI01805 Report

Search the DGRC for FI01805

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:18
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG9192-RA
Protein status:FI01805.pep: gold
Sequenced Size:1197

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9192 2008-04-29 Release 5.5 accounting
CG9192 2008-08-15 Release 5.9 accounting
CG9192 2008-12-18 5.12 accounting

Clone Sequence Records

FI01805.complete Sequence

1197 bp assembled on 2007-09-04

GenBank Submission: BT030801

> FI01805.complete
AACTATTCTGTTGCGGGAGCTTGCCGCGATCAAGCGCAAAAATCGGGTCA
GTGTGTAATCGAACAAAGCGTGCCAATCATGCCAAGCTATTGCCTCATCA
TCGTCCTATGCCTTCTTGGATCAGTGGCGGCTAAGTCTTCGGATGGAGAT
CGAGATCAGTGGGTCTGGAGGTCCTACAATCGCAGGGAGCGCTCTTTTCG
GGACATCAATCGCAGTTCCCCCATAAGGAACTCGTACGACGAAAAGCTGA
GGCGGGAGCCCACGACTCGAAGACCTTTTCCGGGCGAACCGGAGAATGAT
GAGATAGAGGACTATGCCGATGTGGAGCCCACCAGGTCATCGGACACTCC
CAACGTAGGCACCCGTCAGTTTAATCCATACGGTGGTCAGACCAATGCCG
GACAGTTCGGAGGACTTGGAGGCTATAACGGAAACCCCGGAGTGCTAGTC
GGACCTGGCGGACCCACCGGAATCATAGGGAGACCGCAGCTATACCCCAC
TCCCTATCAGCCAGGCTATGGTGGATTCTCTGGAGCTCAAAATGGCATTA
GTGGATATCCAGGCGGATACGGAGGAGTAGGACAGGGACTTCCCGGAGCT
GGATTCCCCGGAGCCAGCGTGGGTGGTGGGTTTAACAACTTCCCCAGTAA
TGGACTTGGCCTCAACCAATTTCCTGGCAATGGGCAATACCCTTACGGCT
CCTATCCAGGTGGCGACTTCGGTGGAAGCCAATTCGCGGGCGCAGGTGCC
CAGTTCCCAGGATTGGGACAGTACCCAGCAAACCAACAGTTCGGTGGACC
TCAGTACACCGAGGGCTATGGTCTGGCAGGAGGACTGGGCTTAGGTCAAC
TTGGAGTAGGCAACGGTGGACTCGGATACGGTGGAAGTTTTCCACCTCTA
GGAGGAGGCTTCGGCTATGACGAGAAATCGCCAGCTGTGGCCGATGGTAA
GAGTGCTAAGAGTGTGGCAGCGTCACCCAGAAAAGTGAATGATAAGCTCA
GTAAGAAGGTCTAGAGCTTCGTGTTTTAGAAGTGGAAGGTGTTATGTTAA
AGATATGGAACTGAAGCTATTACTTTCCCACTCAACCCTCCTTTTTCCCT
TAGGCTGAGTTGGAAGTAGTCACCTTAGTGTAGGCATAGTTTACGTATAG
ACTAAGCAAATAAATTCCCATGTTTACTCACAAAAAAAAAAAAAAAA

FI01805.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9192-RA 1182 CG9192-RA 1..1182 1..1182 5910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1236637..1237817 1181..1 5665 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:06:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1237132..1238313 1182..1 5910 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1237132..1238313 1182..1 5910 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:06:43 has no hits.

FI01805.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:07:54 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1236637..1237817 1..1181 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:38:27 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..936 79..1014 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:22:46 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..936 79..1014 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:52 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..936 79..1014 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:43:13 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..936 79..1014 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:58:02 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..936 79..1014 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:38:22 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..1181 1..1181 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:22:46 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..1181 1..1181 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:52 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 7..1187 1..1181 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:43:13 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 1..1181 1..1181 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:58:02 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
CG9192-RA 7..1187 1..1181 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:54 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1237133..1238313 1..1181 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:54 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1237133..1238313 1..1181 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:54 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1237133..1238313 1..1181 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:52 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1237133..1238313 1..1181 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:54:33 Download gff for FI01805.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1237133..1238313 1..1181 100   Minus

FI01805.hyp Sequence

Translation from 1 to 1013

> FI01805.hyp
NYSVAGACRDQAQKSGQCVIEQSVPIMPSYCLIIVLCLLGSVAAKSSDGD
RDQWVWRSYNRRERSFRDINRSSPIRNSYDEKLRREPTTRRPFPGEPEND
EIEDYADVEPTRSSDTPNVGTRQFNPYGGQTNAGQFGGLGGYNGNPGVLV
GPGGPTGIIGRPQLYPTPYQPGYGGFSGAQNGISGYPGGYGGVGQGLPGA
GFPGASVGGGFNNFPSNGLGLNQFPGNGQYPYGSYPGGDFGGSQFAGAGA
QFPGLGQYPANQQFGGPQYTEGYGLAGGLGLGQLGVGNGGLGYGGSFPPL
GGGFGYDEKSPAVADGKSAKSVAASPRKVNDKLSKKV*

FI01805.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9192-PA 311 CG9192-PA 1..311 27..337 1707 100 Plus
Cpr47Ef-PD 601 CG13214-PD 308..492 127..305 219 37.1 Plus
Cpr47Ef-PD 601 CG13214-PD 376..537 127..317 211 36.5 Plus
Cpr47Ef-PC 612 CG13214-PC 308..481 127..306 209 36.8 Plus
Cpr47Ef-PC 612 CG13214-PC 376..548 127..317 207 36.1 Plus
Cpr47Ef-PD 601 CG13214-PD 265..443 128..305 201 39.2 Plus
prc-PB 1713 CG5700-PB 794..1026 110..306 192 35.1 Plus
CG17108-PA 342 CG17108-PA 134..329 124..325 188 34.6 Plus
Cpr47Ef-PC 612 CG13214-PC 265..443 128..305 182 37.7 Plus
Cpr47Ef-PC 612 CG13214-PC 243..417 128..305 173 36.1 Plus
Cpr47Ef-PD 601 CG13214-PD 236..417 140..305 172 38.5 Plus
prc-PB 1713 CG5700-PB 934..1136 127..302 172 36.4 Plus
Cpr47Ef-PC 612 CG13214-PC 242..377 171..305 170 40.6 Plus
prc-PB 1713 CG5700-PB 526..689 128..305 167 38.8 Plus
prc-PB 1713 CG5700-PB 1050..1261 128..321 167 31.7 Plus
Cpr47Ef-PD 601 CG13214-PD 442..598 127..289 166 35.5 Plus
prc-PB 1713 CG5700-PB 230..449 127..326 166 34.3 Plus
prc-PB 1713 CG5700-PB 305..551 128..326 165 33.5 Plus
prc-PB 1713 CG5700-PB 611..781 128..312 164 38.6 Plus
prc-PB 1713 CG5700-PB 744..925 127..302 156 36.2 Plus
Cpr47Ef-PC 612 CG13214-PC 502..604 127..245 154 37.7 Plus

FI01805.pep Sequence

Translation from 78 to 1013

> FI01805.pep
MPSYCLIIVLCLLGSVAAKSSDGDRDQWVWRSYNRRERSFRDINRSSPIR
NSYDEKLRREPTTRRPFPGEPENDEIEDYADVEPTRSSDTPNVGTRQFNP
YGGQTNAGQFGGLGGYNGNPGVLVGPGGPTGIIGRPQLYPTPYQPGYGGF
SGAQNGISGYPGGYGGVGQGLPGAGFPGASVGGGFNNFPSNGLGLNQFPG
NGQYPYGSYPGGDFGGSQFAGAGAQFPGLGQYPANQQFGGPQYTEGYGLA
GGLGLGQLGVGNGGLGYGGSFPPLGGGFGYDEKSPAVADGKSAKSVAASP
RKVNDKLSKKV*

FI01805.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10069-PA 298 GF10069-PA 1..298 1..311 853 77.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14614-PA 320 GG14614-PA 1..320 1..311 1141 88.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16011-PA 322 GH16011-PA 1..317 1..308 594 50.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9192-PA 311 CG9192-PA 1..311 1..311 1707 100 Plus
Cpr47Ef-PD 601 CG13214-PD 308..492 101..279 219 37.1 Plus
Cpr47Ef-PD 601 CG13214-PD 376..537 101..291 211 36.5 Plus
Cpr47Ef-PC 612 CG13214-PC 308..481 101..280 209 36.8 Plus
Cpr47Ef-PC 612 CG13214-PC 376..548 101..291 207 36.1 Plus
Cpr47Ef-PD 601 CG13214-PD 265..443 102..279 201 39.2 Plus
prc-PB 1713 CG5700-PB 794..1026 84..280 192 35.1 Plus
CG17108-PA 342 CG17108-PA 134..329 98..299 188 34.6 Plus
Cpr47Ef-PC 612 CG13214-PC 265..443 102..279 182 37.7 Plus
Cpr47Ef-PC 612 CG13214-PC 243..417 102..279 173 36.1 Plus
Cpr47Ef-PD 601 CG13214-PD 236..417 114..279 172 38.5 Plus
prc-PB 1713 CG5700-PB 934..1136 101..276 172 36.4 Plus
Cpr47Ef-PC 612 CG13214-PC 242..377 145..279 170 40.6 Plus
glo-PA 586 CG6946-PA 308..477 92..281 168 31.2 Plus
glo-PB 586 CG6946-PB 308..477 92..281 168 31.2 Plus
prc-PB 1713 CG5700-PB 526..689 102..279 167 38.8 Plus
prc-PB 1713 CG5700-PB 1050..1261 102..295 167 31.7 Plus
Cpr47Ef-PD 601 CG13214-PD 442..598 101..263 166 35.5 Plus
prc-PB 1713 CG5700-PB 230..449 101..300 166 34.3 Plus
resilin-PA 620 CG15920-PA 149..343 84..286 166 32 Plus
prc-PB 1713 CG5700-PB 305..551 102..300 165 33.5 Plus
prc-PB 1713 CG5700-PB 611..781 102..286 164 38.6 Plus
CG17108-PA 342 CG17108-PA 161..340 102..271 164 34.8 Plus
CG5172-PD 172 CG5172-PD 18..172 105..271 157 36.6 Plus
CG15140-PB 335 CG15140-PB 111..295 93..279 157 34 Plus
prc-PB 1713 CG5700-PB 744..925 101..276 156 36.2 Plus
CG17108-PA 342 CG17108-PA 70..238 102..279 156 32.3 Plus
Cpr47Ef-PC 612 CG13214-PC 502..604 101..219 154 37.7 Plus
Cpr47Ef-PC 612 CG13214-PC 442..606 101..285 152 36 Plus
HnRNP-K-PD 315 CG13425-PD 50..232 98..288 150 31.4 Plus
CG2157-PB 247 CG2157-PB 77..238 101..280 149 31.6 Plus
CG14326-PA 137 CG14326-PA 19..137 79..211 148 35.9 Plus
Edg91-PB 151 CG7539-PB 28..150 114..266 146 32.7 Plus
Edg91-PA 159 CG7539-PA 36..158 114..266 146 32.7 Plus
CG7296-PB 161 CG7296-PB 32..137 151..290 145 38.6 Plus
CG7296-PA 161 CG7296-PA 32..137 151..290 145 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12277-PA 344 GI12277-PA 1..168 1..157 349 55.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16081-PA 293 GL16081-PA 18..227 15..200 465 63.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21601-PA 338 GA21601-PA 18..338 15..311 643 65.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14228-PA 310 GM14228-PA 1..310 1..311 1493 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13490-PA 310 GD13490-PA 1..310 1..311 1476 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13213-PA 326 GJ13213-PA 1..326 1..311 565 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11932-PA 305 GK11932-PA 1..305 1..311 516 54.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20975-PA 312 GE20975-PA 1..312 1..311 1217 94.6 Plus