Clone FI02040 Report

Search the DGRC for FI02040

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG13305-RC
Protein status:FI02040.pep: gold
Sequenced Size:1149

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13305 2008-08-15 Release 5.9 accounting
CG13305 2008-12-18 5.12 accounting

Clone Sequence Records

FI02040.complete Sequence

1149 bp assembled on 2008-07-31

GenBank Submission: BT044088.1

> FI02040.complete
AGTTGGATTCTAGGTCTCATCCCCGTCAGTCTAGCTGATTTTCCTCTTTT
TTTTGGTTTTTTCTATTTTACAATTTTCTCGCATTTTATTTGCCATATCT
TATATAAGCCCTGCAGCTGACCGTTGGAGCATTGCGCAATCCGGGGCAGC
AGCGTCGATCGATTTCACACACCGCTGACTGCTGGGCAAGTGACTTCCGG
CTTTTGGCCAAGCCCCGAAAAGTGGCCAACTATAAATGGCTATGTTGTTG
TCAAAATGCTGCCACAAATTTGACGAGAGTGCAACGCGATGGATCTGCCA
ATTGGAAAGTTAAACGGACTGCTAAAGATGCAAATATTCCTCCTGCAATT
GTTGCTTTTCGTTTCGCCGGCATTGTTGCAGCAGCCACATGTCTTTTACC
ATCCAAGACAATTGTATTACGATTCACCGCGTCTTCGTCGCTTTGAGTAT
GGTGCCGCTGCCACGCCCATTGTGGGCGGCTATAGTCCGGCTCCTCCGCC
GGCGATTCACTTTCAGCAGCAGACGCCACACTTTCAGCTGATTAACTATC
GGCCGAGTTATCAGCCCTTGGGCTTGGATTACCAGCAGCAGCAGTTGCCC
GCTCCTGCCGCACCCCCTCCGCCCCTGTATCCGCAGCAGAGTGTCCAGTA
CCAGCAGCGGACCATCGCTCCACACGCCGATTTGGCCAAATATCGATATG
AAGATTGCAGGAGCAGCAGCAGCAGCAACCCTCACAGAATGTCCAAACGG
AAAGACCCAGGAGGTACGCCAAGGATCTGGACACGGATGTGGCCGAAACC
AGAAGTCCAGCTGACCGAAGTGCCAAGGAAACCAAGTACTTTCATGACAT
TTTCATGCGCTTTGATGCACCCGATTCGCGGAGTCATGGCCACGTCCTGA
AGCATCCGAAGGCCCAGGAAAAGCGATTTGAATCCCAGCGAGGCACGAAT
CGTTACAAGGGCGAGGTGATTTGGACAGATCGTCAAGGAGGTCACGGCGA
ACATCGTTGGGACATGGCGCAGGGAAAACTCTGAGATCAGACCTCGATTT
GCATACTCCATAACATTTTTCCCATCCCCCCCAAAAACTCTCTGTACATA
CCCATGCGAACTCGCATAAATCGTGACTTTTCATAAAAAAAAAAAAAAA

FI02040.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13305-RC 1138 CG13305-RC 1..1136 1..1136 5650 99.8 Plus
CG13305-RB 1564 CG13305-RB 1..703 1..703 3485 99.7 Plus
CG13305.a 1929 CG13305.a 1..703 1..703 3485 99.7 Plus
CG13305-RB 1564 CG13305-RB 928..1362 702..1136 2175 100 Plus
CG13305.a 1929 CG13305.a 928..1362 702..1136 2175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8638130..8638825 703..7 3315 98.7 Minus
chr3L 24539361 chr3L 8636925..8637095 1134..964 855 100 Minus
chr3L 24539361 chr3L 8637763..8637905 844..702 685 98.6 Minus
chr3L 24539361 chr3L 8637169..8637297 973..845 615 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8646116..8646818 703..1 3485 99.7 Minus
3L 28110227 3L 8644914..8645086 1136..964 865 100 Minus
3L 28110227 3L 8645749..8645891 844..702 715 100 Minus
3L 28110227 3L 8645160..8645288 973..845 630 99.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8639216..8639918 703..1 3485 99.7 Minus
3L 28103327 3L 8638014..8638186 1136..964 865 100 Minus
3L 28103327 3L 8638849..8638991 844..702 715 100 Minus
3L 28103327 3L 8638260..8638388 973..845 630 99.2 Minus
Blast to na_te.dros performed on 2019-03-15 14:50:16 has no hits.

FI02040.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:50:58 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8636925..8637093 966..1134 100 <- Minus
chr3L 8637177..8637297 845..965 99 <- Minus
chr3L 8637763..8637903 704..844 98 <- Minus
chr3L 8638130..8638831 1..703 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:39:25 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..612 289..900 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:27 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..612 289..900 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:45:28 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..612 289..900 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:30 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..612 289..900 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:27 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..612 289..900 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:05 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..1134 1..1134 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:27 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..1134 1..1134 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:45:28 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 5..1138 1..1134 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 11:07:10 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 1..1134 1..1134 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:27 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
CG13305-RC 5..1138 1..1134 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:58 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8644916..8645084 966..1134 100 <- Minus
3L 8645168..8645288 845..965 100 <- Minus
3L 8645749..8645889 704..844 100 <- Minus
3L 8646116..8646818 1..703 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:58 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8644916..8645084 966..1134 100 <- Minus
3L 8645168..8645288 845..965 100 <- Minus
3L 8645749..8645889 704..844 100 <- Minus
3L 8646116..8646818 1..703 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:58 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8644916..8645084 966..1134 100 <- Minus
3L 8645168..8645288 845..965 100 <- Minus
3L 8645749..8645889 704..844 100 <- Minus
3L 8646116..8646818 1..703 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:45:28 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8638016..8638184 966..1134 100 <- Minus
arm_3L 8638268..8638388 845..965 100 <- Minus
arm_3L 8638849..8638989 704..844 100 <- Minus
arm_3L 8639216..8639918 1..703 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:28 Download gff for FI02040.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8639216..8639918 1..703 99   Minus
3L 8638016..8638184 966..1134 100 <- Minus
3L 8638268..8638388 845..965 100 <- Minus
3L 8638849..8638989 704..844 100 <- Minus

FI02040.pep Sequence

Translation from 288 to 899

> FI02040.pep
MDLPIGKLNGLLKMQIFLLQLLLFVSPALLQQPHVFYHPRQLYYDSPRLR
RFEYGAAATPIVGGYSPAPPPAIHFQQQTPHFQLINYRPSYQPLGLDYQQ
QQLPAPAAPPPPLYPQQSVQYQQRTIAPHADLAKYRYEDCRSSSSSNPHR
MSKRKDPGGTPRIWTRMWPKPEVQLTEVPRKPSTFMTFSCALMHPIRGVM
ATS*

FI02040.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10153-PA 250 GF10153-PA 12..133 16..144 291 60.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15066-PA 307 GG15066-PA 1..139 1..138 457 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22561-PA 311 GH22561-PA 2..135 7..138 278 60.4 Plus
Dgri\GH16147-PA 314 GH16147-PA 2..135 7..138 278 60.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13305-PC 203 CG13305-PC 1..203 1..203 1100 100 Plus
CG13305-PB 323 CG13305-PB 1..138 1..138 743 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12415-PA 303 GI12415-PA 30..133 34..138 243 64.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10293-PA 309 GL10293-PA 1..146 1..138 271 54.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12185-PA 307 GA12185-PA 1..146 1..138 264 55.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24923-PA 317 GM24923-PA 1..138 1..138 537 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12970-PA 281 GD12970-PA 1..138 1..138 542 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12308-PA 315 GJ12308-PA 23..137 26..138 240 58.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17475-PA 300 GK17475-PA 30..133 38..138 254 57.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21290-PA 320 GE21290-PA 1..138 1..138 465 87 Plus

FI02040.hyp Sequence

Translation from 288 to 899

> FI02040.hyp
MDLPIGKLNGLLKMQIFLLQLLLFVSPALLQQPHVFYHPRQLYYDSPRLR
RFEYGAAATPIVGGYSPAPPPAIHFQQQTPHFQLINYRPSYQPLGLDYQQ
QQLPAPAAPPPPLYPQQSVQYQQRTIAPHADLAKYRYEDCRSSSSSNPHR
MSKRKDPGGTPRIWTRMWPKPEVQLTEVPRKPSTFMTFSCALMHPIRGVM
ATS*

FI02040.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13305-PC 203 CG13305-PC 1..203 1..203 1100 100 Plus
CG13305-PB 323 CG13305-PB 1..138 1..138 743 100 Plus