Clone FI02086 Report

Search the DGRC for FI02086

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:20
Well:86
Vector:pFlc-1
Associated Gene/TranscriptCG12948-RA
Protein status:FI02086.pep: gold
Sequenced Size:1323

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12948 2008-04-29 Release 5.5 accounting
CG12948 2008-08-15 Release 5.9 accounting
CG12948 2008-12-18 5.12 accounting

Clone Sequence Records

FI02086.complete Sequence

1323 bp assembled on 2007-11-15

GenBank Submission: BT031188

> FI02086.complete
GATTCTCCTGGTTGCGCATCTCTAGATTGCACAAGCCGAGCCTGTTGAAA
AAAAATTTGAAGCGGAAACGGGTTTTACTTTTACTAGCAACTTTAGAGCT
CAACGCTCAGCAGTTAAGCCAGCAGTCTTGACTTGCAGCCGCATCGTAGC
GAACTGTTTTTCGAGTCTCCGAATCCGTGCCAGCGCATCGCTAAATCCAC
TGAAAGCCAGGCAGAGCAACTGCGGGGGCGTTGGGAAAGAGCAATATAAA
CAAACGGAGGCGGGATGTCGATGAGCAATTTATCAATAGACGGCGAGTTC
CGCTACATAATTCAGTGGTTCAACGAGTGGAGTGAACTGCAGCGGGATGA
CTTTGTCTACGTTTTCGTGGAGTACCTGGCCAGGGGATCCAGTTCTGGCG
CCAGCGATGGCCAGGTGAATGGATTGGTCAACTCGCTGGCCAACGCAGCA
GTGCAGGACAAGCCCATGAGCCTGTTCCAATGCCGCATTAAGCTGTTCCG
TGAATGGAGCCCCAAGTGGCCGATCGAGTTCAAATGCAAGCTGCAGGAGA
AGATCAGTGAGATCGACGCGAAGGTGGGGGAGAAGATCATCAATGAGCTT
CGGGGGCCCCATTCCGTGCACAATGGCGACGTAGCCGTACATTTAAATGC
AAATGGAGCGAGCGAAGAGGGCGGAGACTCCGAACTGGAGCAGATGCCAG
AGTCAGAAGTGACGGAGGTCGCCACTTTGGCGGCGGGGCAAGAAGCTGAT
CCAGCTCCCGAAGCAGATGACAATCGCTTGGCGGCGGTCTTAAGCCAAGA
AACGCCCGTTGATGACGACGACGTGGAAAAGTCTGCCGGTGAAGATTGCA
ATAGTAATGCCGATGTAAATGGCCATTATCCAGCGGCTGCAGTGACAACG
ATTGCGGTGAATATATCACCATCGCCATCCCCCACTCCCCAGCCGATTGT
TGAACCTGTAGAACAGGTCGAGAATAGCGTTACAGTCACCGTGGCTTCTC
CAGAAGTTCCCCCCGTGGCTTAGGCCAGGAACGATCGTTAAAGACAAACC
AGATCGACTATAAAAAATGCCTAATGAGTAGTTAAGTATTTTAGTTGTAC
ATCATCGGCAACTCGACATTCCACGCGATGCATTTCTAGTTACGTAAGCC
AATCTCTGGGCCCGAGCCCACTTCTGGGCTAGGCCGACTAAAAAGACTTT
GTTCGCACTCTGTAGCCCTTAGCCACGTTCATTTCATCGCCTAACTTAAG
AGCATAAACTTTAAAGTAAGCGTCAATAATATACATACGAAAGAGAGTTC
CACATTCTAAAAAAAAAAAAAAA

FI02086.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12948-RA 1307 CG12948-RA 1..1307 2..1308 6520 99.9 Plus
CG34409.a 2214 CG34409.a 1..158 1108..1265 790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5572004..5572825 1308..487 4095 99.9 Minus
chr3R 27901430 chr3R 5572885..5573369 486..2 2395 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:07:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9746164..9746988 1311..487 4125 100 Minus
3R 32079331 3R 9747048..9747532 486..2 2410 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9486995..9487819 1311..487 4125 100 Minus
3R 31820162 3R 9487879..9488363 486..2 2410 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 11:38:09 has no hits.

FI02086.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:39:08 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5572004..5572825 487..1308 99 <- Minus
chr3R 5572885..5573369 1..486 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:39:57 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..759 265..1023 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:01:35 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..759 265..1023 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:07:40 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..759 265..1023 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:46:59 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..759 265..1023 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:28 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..759 265..1023 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:45:29 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..1307 2..1308 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:01:35 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..1307 2..1308 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:07:40 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..1307 2..1308 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:47:00 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RA 1..1307 2..1308 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:28 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
CG12948-RB 212..1519 1..1308 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:08 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9746167..9746988 487..1308 100 <- Minus
3R 9747048..9747532 1..486 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:08 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9746167..9746988 487..1308 100 <- Minus
3R 9747048..9747532 1..486 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:39:08 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9746167..9746988 487..1308 100 <- Minus
3R 9747048..9747532 1..486 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:07:40 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5571889..5572710 487..1308 100 <- Minus
arm_3R 5572770..5573254 1..486 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:53:30 Download gff for FI02086.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9486998..9487819 487..1308 100 <- Minus
3R 9487879..9488363 1..486 99   Minus

FI02086.hyp Sequence

Translation from 264 to 1022

> FI02086.hyp
MSMSNLSIDGEFRYIIQWFNEWSELQRDDFVYVFVEYLARGSSSGASDGQ
VNGLVNSLANAAVQDKPMSLFQCRIKLFREWSPKWPIEFKCKLQEKISEI
DAKVGEKIINELRGPHSVHNGDVAVHLNANGASEEGGDSELEQMPESEVT
EVATLAAGQEADPAPEADDNRLAAVLSQETPVDDDDVEKSAGEDCNSNAD
VNGHYPAAAVTTIAVNISPSPSPTPQPIVEPVEQVENSVTVTVASPEVPP
VA*

FI02086.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12948-PB 252 CG12948-PB 1..252 1..252 1304 100 Plus
CG12948-PA 252 CG12948-PA 1..252 1..252 1304 100 Plus

FI02086.pep Sequence

Translation from 264 to 1022

> FI02086.pep
MSMSNLSIDGEFRYIIQWFNEWSELQRDDFVYVFVEYLARGSSSGASDGQ
VNGLVNSLANAAVQDKPMSLFQCRIKLFREWSPKWPIEFKCKLQEKISEI
DAKVGEKIINELRGPHSVHNGDVAVHLNANGASEEGGDSELEQMPESEVT
EVATLAAGQEADPAPEADDNRLAAVLSQETPVDDDDVEKSAGEDCNSNAD
VNGHYPAAAVTTIAVNISPSPSPTPQPIVEPVEQVENSVTVTVASPEVPP
VA*

FI02086.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23195-PA 255 GF23195-PA 1..255 1..252 879 71.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17332-PA 252 GG17332-PA 1..252 1..252 1111 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14271-PA 277 GH14271-PA 1..277 1..252 776 60.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG12948-PB 252 CG12948-PB 1..252 1..252 1304 100 Plus
CG12948-PA 252 CG12948-PA 1..252 1..252 1304 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24875-PA 288 GI24875-PA 1..288 1..252 716 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23237-PA 273 GL23237-PA 1..273 1..252 748 64.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11931-PA 273 GA11931-PA 1..273 1..252 739 65.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26219-PA 252 GM26219-PA 1..252 1..252 1303 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20764-PA 252 GD20764-PA 1..252 1..252 1308 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24519-PA 283 GJ24519-PA 1..283 1..252 730 61.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11129-PA 253 GK11129-PA 1..211 1..216 685 68.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24737-PA 252 GE24737-PA 1..252 1..252 1190 95.6 Plus