Clone FI02803 Report

Search the DGRC for FI02803

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:3
Vector:pFlc-1
Associated Gene/TranscriptGstT3-RA
Protein status:FI02803.pep: gold
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1702 2008-08-15 Release 5.9 accounting
CG1702 2008-12-18 5.12 accounting

Clone Sequence Records

FI02803.complete Sequence

888 bp assembled on 2008-07-31

GenBank Submission: BT032646

> FI02803.complete
GCGTTGCCCACCGACCGTGTTTGTGTTCCCTCCAGACAGCCAACCAACCT
GAGGATGTCCGCTCCCATTCGCTACTACTATGACCTGATGTCGCAGCCCT
CGAGGGCGTTGTTCATTATCTTCCGGCTGAGCAACATGCCCTTCGAAGAC
TGCGTGGTTGCCCTGCGCAATGGCGAGCACTTGACCGAAGACTTCAAGAA
GGAGATTAACCGCTTCCAGCGTGTGCCCTGCATCCACGACAATGGCTACA
AGCTAGCGGAGAGCGTGGCCATCCTGCGCTATTTGAGCGCCAAGGGCAAG
ATACCGGAGCACCTCTATCCCAAGTACTTCGTTGACCAGAGCCGCGTCGA
CGAGTTCCTCGAATGGCAGCACATGTCCCTGCGGCTCACCTGCGCCATGT
ACTTCCGCACCGTGTGGCTGGAGCCGCTTCTGACAGGACGCACACCCTCC
GAAGCCAAAATCGAGACGTTCCGCATGCAGATGGAGCGCAACCTCGACGT
AGTCGAGGAGGTCTGGCTGGAGGGCAAGGACTTCCTCACCGGATCCTCCC
TCACCGTTGCGGACATCTTTGCAGCCTGTGAAATCGAACAGACACGAATG
GCCGACTACGATGTCAGGATCAAGTACCCCAAGATCAGGGCGTGGCTGAA
GAGAGTGCGCCAGAGCTGCAATCCGTACTACGATGTGGCCCACGAGTTCG
TCTACAAAATCTCCGGAACGGGTCCACAGGCCAAGCTATAAACTCCAACG
TTCACAAAGCCATTCTGTACATAGATCATTATCATTGCTGGGTACTTATA
TGTAGTTGATAAACAAAACGATAATAAAACAGAGCTTGTCGCTGGTTTAT
ACTTGTACAATTTATTCGTAATAAAAAAAAAAAAAAAA

FI02803.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1702-RA 1156 CG1702-RA 200..1070 3..873 4355 100 Plus
CG1702-RB 1250 CG1702-RB 316..1164 25..873 4245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20334564..20334988 172..596 2065 99.1 Plus
chrX 22417052 chrX 20335049..20335325 596..872 1385 100 Plus
chrX 22417052 chrX 20334081..20334229 25..173 730 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20469035..20469459 172..596 2125 100 Plus
X 23542271 X 20469520..20469797 596..873 1390 100 Plus
X 23542271 X 20468546..20468694 25..173 745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20454127..20454551 172..596 2125 100 Plus
X 23527363 X 20454612..20454889 596..873 1390 100 Plus
X 23527363 X 20453638..20453786 25..173 745 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:33:09 has no hits.

FI02803.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:34:05 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20333922..20333947 1..25 96 -> Plus
chrX 20334082..20334228 26..172 99 -> Plus
chrX 20334565..20334987 173..595 99 -> Plus
chrX 20335049..20335325 596..872 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:15 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
CG1702-RB 91..807 25..741 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:23 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
CG1702-RB 91..807 25..741 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:14:00 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
GstT3-RB 91..807 25..741 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:38 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
CG1702-RA 1..687 55..741 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:46 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
GstT3-RB 91..807 25..741 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:00 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
CG1702-RA 1..870 3..872 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:23 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
CG1702-RA 1..870 3..872 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:14:00 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
GstT3-RA 3..875 1..872 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 11:07:04 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
CG1702-RA 1..873 1..872 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:46 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
GstT3-RA 3..875 1..872 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:05 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
X 20468387..20468412 1..25 96 -> Plus
X 20468547..20468693 26..172 100 -> Plus
X 20469036..20469458 173..595 100 -> Plus
X 20469520..20469796 596..872 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:05 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
X 20468387..20468412 1..25 96 -> Plus
X 20468547..20468693 26..172 100 -> Plus
X 20469036..20469458 173..595 100 -> Plus
X 20469520..20469796 596..872 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:05 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
X 20468387..20468412 1..25 96 -> Plus
X 20468547..20468693 26..172 100 -> Plus
X 20469036..20469458 173..595 100 -> Plus
X 20469520..20469796 596..872 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:14:00 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20339414..20339439 1..25 96 -> Plus
arm_X 20339574..20339720 26..172 100 -> Plus
arm_X 20340063..20340485 173..595 100 -> Plus
arm_X 20340547..20340823 596..872 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:24 Download gff for FI02803.complete
Subject Subject Range Query Range Percent Splice Strand
X 20454128..20454550 173..595 100 -> Plus
X 20454612..20454888 596..872 100   Plus
X 20453479..20453504 1..25 96 -> Plus
X 20453639..20453785 26..172 100 -> Plus

FI02803.pep Sequence

Translation from 0 to 740

> FI02803.pep
ALPTDRVCVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFED
CVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGK
IPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPS
EAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRM
ADYDVRIKYPKIRAWLKRVRQSCNPYYDVAHEFVYKISGTGPQAKL*

FI02803.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15963-PA 269 GF15963-PA 32..269 9..246 1218 92.4 Plus
Dana\GF12484-PA 228 GF12484-PA 1..228 19..246 613 52.6 Plus
Dana\GF12486-PA 226 GF12486-PA 1..220 19..238 565 50 Plus
Dana\GF12485-PA 228 GF12485-PA 1..228 19..246 537 47 Plus
Dana\GF22526-PA 235 GF22526-PA 1..226 19..241 458 36.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19687-PA 268 GG19687-PA 31..268 9..246 1272 98.3 Plus
Dere\GG24094-PA 228 GG24094-PA 1..227 19..245 613 51.1 Plus
Dere\GG24095-PA 228 GG24095-PA 1..228 19..246 547 47 Plus
Dere\GG17782-PA 237 GG17782-PA 1..228 19..245 475 36.4 Plus
Dere\GG19896-PA 223 GG19896-PA 1..198 19..227 195 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17734-PA 261 GH17734-PA 22..261 6..246 1082 80.9 Plus
Dgri\GH22936-PA 228 GH22936-PA 1..228 19..246 557 46.3 Plus
Dgri\GH12904-PA 239 GH12904-PA 1..220 19..237 461 37.3 Plus
Dgri\GH13103-PA 209 GH13103-PA 4..189 25..221 194 27.9 Plus
Dgri\GH20186-PA 209 GH20186-PA 4..189 25..221 193 27.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
GstT3-PB 268 CG1702-PB 31..268 9..246 1260 100 Plus
GstT3-PC 228 CG1702-PC 1..228 19..246 1208 100 Plus
GstT3-PA 228 CG1702-PA 1..228 19..246 1208 100 Plus
GstT1-PA 228 CG30000-PA 1..227 19..245 593 51.1 Plus
GstT2-PA 228 CG30005-PA 1..228 19..246 532 47.8 Plus
GstT4-PA 237 CG1681-PA 1..224 19..241 461 36.6 Plus
GstE3-PA 220 CG17524-PA 12..201 31..231 198 29.7 Plus
GstE4-PA 222 CG17525-PA 12..202 31..231 197 30.6 Plus
GstE12-PC 223 CG16936-PC 1..198 19..227 191 32.9 Plus
GstE12-PB 223 CG16936-PB 1..198 19..227 191 32.9 Plus
GstE12-PD 223 CG16936-PD 1..198 19..227 191 32.9 Plus
GstE12-PA 223 CG16936-PA 1..198 19..227 191 32.9 Plus
GstE7-PA 223 CG17531-PA 12..202 31..231 189 29.6 Plus
GstD11-PB 243 CG17639-PB 21..217 18..226 179 29.7 Plus
GstD1-PB 209 CG10045-PB 2..189 23..221 177 27.6 Plus
GstD1-PA 209 CG10045-PA 2..189 23..221 177 27.6 Plus
GstD11-PA 222 CG17639-PA 1..196 19..226 177 29.9 Plus
GstE1-PA 224 CG5164-PA 3..204 20..232 173 28.2 Plus
GstD4-PA 215 CG11512-PA 3..188 25..221 172 25.4 Plus
GstE2-PA 221 CG17523-PA 1..199 19..228 169 31.5 Plus
GstE5-PA 222 CG17527-PA 12..202 31..231 169 27.7 Plus
GstD3-PA 199 CG4381-PA 8..172 46..221 168 28.4 Plus
GstD6-PA 215 CG4423-PA 4..194 27..228 165 28.1 Plus
GstD9-PB 218 CG10091-PB 4..191 25..221 157 26.4 Plus
GstD9-PA 218 CG10091-PA 4..191 25..221 157 26.4 Plus
GstD7-PA 224 CG4371-PA 11..188 30..217 152 26.5 Plus
GstD5-PA 216 CG12242-PA 3..188 25..221 145 24.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15481-PA 269 GI15481-PA 30..269 9..246 1053 79.2 Plus
Dmoj\GI14608-PA 237 GI14608-PA 3..227 22..245 478 38.2 Plus
Dmoj\GI18422-PA 226 GI18422-PA 1..216 19..234 453 41.6 Plus
Dmoj\GI19515-PA 223 GI19515-PA 1..203 19..232 198 31.2 Plus
Dmoj\GI24379-PA 209 GI24379-PA 2..189 23..221 197 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15796-PA 269 GL15796-PA 31..269 9..246 1165 89.5 Plus
Dper\GL17152-PA 228 GL17152-PA 1..228 19..246 626 53 Plus
Dper\GL17151-PA 111 GL17151-PA 1..111 19..130 309 51.8 Plus
Dper\GL26999-PA 280 GL26999-PA 133..260 111..237 218 32.8 Plus
Dper\GL27304-PA 222 GL27304-PA 1..196 19..226 197 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23260-PA 269 GA23260-PA 31..269 9..246 1161 88.7 Plus
Dpse\GA15569-PA 228 GA15569-PA 1..228 19..246 630 53 Plus
Dpse\GA24982-PA 228 GA24982-PA 1..228 19..246 561 47.8 Plus
Dpse\GA14161-PA 240 GA14161-PA 1..220 19..237 464 37.3 Plus
Dpse\GA14590-PA 222 GA14590-PA 1..196 19..226 197 30.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21142-PA 228 GM21142-PA 1..227 19..245 614 51.5 Plus
Dsec\GM21143-PA 228 GM21143-PA 1..228 19..246 562 48.3 Plus
Dsec\GM11633-PA 237 GM11633-PA 1..224 19..241 472 36.6 Plus
Dsec\GM23038-PA 87 GM23038-PA 30..87 190..246 254 82.8 Plus
Dsec\GM23038-PA 87 GM23038-PA 1..40 19..58 213 100 Plus
Dsec\GM21879-PA 222 GM21879-PA 12..202 31..231 205 30.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17492-PA 249 GD17492-PA 31..249 9..246 1140 90.3 Plus
Dsim\GD10672-PA 228 GD10672-PA 1..227 19..245 614 51.5 Plus
Dsim\GD10673-PA 228 GD10673-PA 1..228 19..246 560 48.3 Plus
Dsim\GD17126-PA 288 GD17126-PA 1..275 19..241 413 30.5 Plus
Dsim\GD11371-PA 219 GD11371-PA 12..200 31..231 200 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19193-PA 270 GJ19193-PA 28..270 7..246 1099 81.9 Plus
Dvir\GJ21509-PA 228 GJ21509-PA 1..228 19..246 523 45.2 Plus
Dvir\GJ19422-PA 237 GJ19422-PA 1..229 19..246 480 37.1 Plus
Dvir\GJ24385-PA 209 GJ24385-PA 4..195 25..228 206 29.4 Plus
Dvir\GJ22852-PA 214 GJ22852-PA 1..188 23..221 188 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19806-PA 293 GK19806-PA 68..293 21..246 1099 86.3 Plus
Dwil\GK15954-PA 228 GK15954-PA 1..228 19..246 583 47.6 Plus
Dwil\GK15953-PA 228 GK15953-PA 1..228 19..246 551 46.1 Plus
Dwil\GK25235-PA 236 GK25235-PA 1..214 19..232 448 35.5 Plus
Dwil\GK22983-PA 222 GK22983-PA 12..202 31..231 213 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17886-PA 268 GE17886-PA 31..268 9..246 1277 98.7 Plus
Dyak\GE19294-PA 228 GE19294-PA 1..227 19..245 604 50.7 Plus
Dyak\GE19295-PA 228 GE19295-PA 1..228 19..246 512 45.7 Plus
Dyak\GE17075-PA 234 GE17075-PA 1..224 19..241 472 37.1 Plus
Dyak\GE11964-PA 222 GE11964-PA 12..201 31..231 209 32.5 Plus

FI02803.hyp Sequence

Translation from 1 to 740

> FI02803.hyp
QLPTDRVCVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFED
CVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGK
IPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPS
EAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRM
ADYDVRIKYPKIRAWLKRVRQSCNPYYDVAHEFVYKISGTGPQAKL*

FI02803.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
GstT3-PB 268 CG1702-PB 31..268 9..246 1260 100 Plus
GstT3-PC 228 CG1702-PC 1..228 19..246 1208 100 Plus
GstT3-PA 228 CG1702-PA 1..228 19..246 1208 100 Plus
GstT1-PA 228 CG30000-PA 1..227 19..245 593 51.1 Plus
GstT2-PA 228 CG30005-PA 1..228 19..246 532 47.8 Plus