FI02805.complete Sequence
981 bp assembled on 2009-04-20
GenBank Submission: BT082052.1
> FI02805.complete
CTGAGGTTATTCCGAGAGAGATCATGGATCGGAGAGTGACTGCGATTGGT
TTGGTTATCCTGCAGCTGCTGGTCAGCGGCCTCTGTTTCCAGGAGAAGGC
GCCACTGCAGACGAGCCTGGTCAGCGGACAGGCCAGGACCGAAAAGCAGC
AACAGGTGCTGGACGATCCGCTGGGAAGTGGACGCGGGATTGACGAGCAC
CTGCTGAAGACCATTGGTAAGGGCGGCATCAAGCTGGTGATGGCCTCGGG
AGCCCCGTCGACCACCCCGAAACCGTCAGTACAACACCATTACTATTATC
CACCAGAGGATCAGCAGCACCCACGGCAGTATGGCTATCCACCGCAGTGG
TCGCCAGGACCGCCCGCTTATCCGCCGCCACCGCAGCGTCCTTGGGGGCC
ACCCCCTCCGCCCGGACCACCGCCGCCAGGACCTCCTCCTCCGCCGGGAC
CCTACTACAATCCCTACTACAATGGCTACAACTACTACGGCGGATATGGC
GGCTATGGATATGGGGGCTTTGGATATCCCGGCTTTGGCGGCTATTCTGG
CTATCCCTACTATCCCTTCTATCGCTCCTCGACGGCTGGCGAGGTCGATA
ACCAACTTCCCGGTGCCGATGGACTCACTTCCGCCGCCATTCCTGGCGTT
TTCCAGGGCAGGGCCGTGCTGTCCCACCAGAACTTCCTCGACGGCAGGAA
CAACGCTAACGTTGTGCCACTTTATCACCTACTCCAAATGGCCAGGGCTT
GAAGTACTCTAATCCAATCATTGATTAAAACTTAATAAATTGTGTACCAT
GTATATTCCGAGTAACCGCGTGATGCATTGTAGTTCTTACTTATCATCGC
ATGCGTTCTAGTTTATAGCCCTATTCAATATCTAATCGATTCTGACTGGA
TAAATGTTTAAAGAAATCGTCCAACTGAAAGCCCATAATAGTAGAAACAG
AATTGCAGAAAGGAGAAAAAAAAAAAAAAAA
FI02805.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:30:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9184-RA | 1350 | CG9184-RA | 273..1237 | 4..968 | 4825 | 100 | Plus |
CG9184.b | 1685 | CG9184.b | 608..1572 | 4..968 | 4825 | 100 | Plus |
CG9184.a | 990 | CG9184.a | 25..983 | 4..968 | 4710 | 99.3 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:21:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 1321288..1322199 | 965..54 | 4395 | 98.8 | Minus |
chr3L | 24539361 | chr3L | 1322248..1322298 | 54..4 | 255 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 1321789..1322703 | 968..54 | 4575 | 100 | Minus |
3L | 28110227 | 3L | 1322752..1322802 | 54..4 | 255 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 1321789..1322703 | 968..54 | 4575 | 100 | Minus |
3L | 28103327 | 3L | 1322752..1322802 | 54..4 | 255 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 20:21:05 has no hits.
FI02805.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:21:59 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 1321288..1322198 | 55..965 | 98 | <- | Minus |
chr3L | 1322248..1322299 | 1..54 | 96 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:42 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 1..729 | 24..752 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:00 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 1..729 | 24..752 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:09 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 1..729 | 24..752 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:58 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 1..729 | 24..752 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-20 13:34:18 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 1..962 | 4..965 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:00 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 1..962 | 4..965 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:09 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 2..966 | 1..965 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:58 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9184-RA | 2..966 | 1..965 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:59 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 1321792..1322702 | 55..965 | 100 | <- | Minus |
3L | 1322752..1322803 | 1..54 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:59 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 1321792..1322702 | 55..965 | 100 | <- | Minus |
3L | 1322752..1322803 | 1..54 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:59 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 1321792..1322702 | 55..965 | 100 | <- | Minus |
3L | 1322752..1322803 | 1..54 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:09 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 1321792..1322702 | 55..965 | 100 | <- | Minus |
arm_3L | 1322752..1322803 | 1..54 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:19 Download gff for
FI02805.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 1321792..1322702 | 55..965 | 100 | <- | Minus |
3L | 1322752..1322803 | 1..54 | 96 | | Minus |
FI02805.hyp Sequence
Translation from 1 to 751
> FI02805.hyp
QVIPREIMDRRVTAIGLVILQLLVSGLCFQEKAPLQTSLVSGQARTEKQQ
QVLDDPLGSGRGIDEHLLKTIGKGGIKLVMASGAPSTTPKPSVQHHYYYP
PEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP
YYNPYYNGYNYYGGYGGYGYGGFGYPGFGGYSGYPYYPFYRSSTAGEVDN
QLPGADGLTSAAIPGVFQGRAVLSHQNFLDGRNNANVVPLYHLLQMARA*
FI02805.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9184-PA | 242 | CG9184-PA | 1..242 | 8..249 | 1363 | 100 | Plus |
CG9184-PB | 212 | CG9184-PB | 1..212 | 8..249 | 1155 | 87.6 | Plus |
CG33003-PA | 579 | CG33003-PA | 397..500 | 80..162 | 153 | 32.7 | Plus |
CG33003-PB | 604 | CG33003-PB | 422..525 | 80..162 | 153 | 32.7 | Plus |
CG10555-PB | 926 | CG10555-PB | 405..533 | 48..185 | 149 | 32.9 | Plus |
FI02805.pep Sequence
Translation from 2 to 751
> FI02805.pep
EVIPREIMDRRVTAIGLVILQLLVSGLCFQEKAPLQTSLVSGQARTEKQQ
QVLDDPLGSGRGIDEHLLKTIGKGGIKLVMASGAPSTTPKPSVQHHYYYP
PEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP
YYNPYYNGYNYYGGYGGYGYGGFGYPGFGGYSGYPYYPFYRSSTAGEVDN
QLPGADGLTSAAIPGVFQGRAVLSHQNFLDGRNNANVVPLYHLLQMARA*
FI02805.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:17:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10064-PA | 205 | GF10064-PA | 127..205 | 171..249 | 199 | 67.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:17:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14608-PA | 211 | GG14608-PA | 1..211 | 8..249 | 572 | 75.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9184-PA | 242 | CG9184-PA | 1..242 | 8..249 | 1363 | 100 | Plus |
CG9184-PB | 212 | CG9184-PB | 1..212 | 8..249 | 1155 | 87.6 | Plus |
CG33003-PA | 579 | CG33003-PA | 397..500 | 80..162 | 153 | 32.7 | Plus |
CG33003-PB | 604 | CG33003-PB | 422..525 | 80..162 | 153 | 32.7 | Plus |
CG10555-PB | 926 | CG10555-PB | 405..533 | 48..185 | 149 | 32.9 | Plus |
CG10555-PA | 926 | CG10555-PA | 405..533 | 48..185 | 149 | 32.9 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:17:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI12270-PA | 289 | GI12270-PA | 1..289 | 8..249 | 186 | 32.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:18:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA21597-PA | 220 | GA21597-PA | 22..85 | 29..125 | 199 | 50.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:18:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14222-PA | 205 | GM14222-PA | 1..205 | 8..249 | 945 | 81.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:18:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13484-PA | 212 | GD13484-PA | 1..212 | 8..249 | 997 | 84.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:18:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK25459-PA | 212 | GK25459-PA | 1..64 | 8..71 | 211 | 67.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:18:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20969-PA | 211 | GE20969-PA | 1..211 | 8..249 | 570 | 79.8 | Plus |