Clone FI02812 Report

Search the DGRC for FI02812

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:12
Vector:pFlc-1
Associated Gene/TranscriptCG9117-RA
Protein status:FI02812.pep: gold
Sequenced Size:924

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9117 2008-08-15 Release 5.9 accounting
CG9117 2008-12-18 5.12 accounting

Clone Sequence Records

FI02812.complete Sequence

924 bp assembled on 2008-07-31

GenBank Submission: BT032647

> FI02812.complete
ATTTCTGTTTGTAAGCAACAGCTGATAAGCAGCTGACCCTAAATAATTTA
ATAGGCTAGAGCGTTATCGTTGTTAAACAACTAAACAATGGCATACACTG
ATCCTGCGCAACGAAACCAGGTGACCGTGCTCCAGGTCGGCTATTCTCGC
CAAGAAGAAGGAGACGAGTCCGCCATGCGGGCTAACTGCACATGCACACT
GGTCCGCTGCCGGGATGGCACCAACATAATCGTGGACACACTGACGGCCT
GGGATGGAGATCACCTGCGTTCGTTGTTGGGCCAGCAGGGACTAGGCGTC
GATGACATCCACGTGGTGGTCTGCTCTCACGGACACTCTGACCACATCGG
TTGCAACTATCTGTTTCAGAAGGCACGAATGCATTTGGTCGGCGCATGTG
CCTCACATCACGACCTCTACATGGACCACCTTGGTAGTGGTAATCCAGAC
GAGCAACTGGCCCTAGATTCGAATGCCGAGGTGGTAGTGAGGCGGTCGCC
AGGACACACCCTCAGCTGCGTTTCAGTTCTTGTGGAAAATTCCCAGCTGG
GTGGACGGGTCGGTATCACCGGAGATCTCTTCGAGCGTCGCGAGGACATC
GACGATGAGAACATTTGGATGGACGCTGGAAGCGAAAACGAGAAGGTGCA
GCGCGAGGAGCGCAGTAAAATGGCACAACTGTGCGAGTTTATAATCCCAG
GACATGGTCCGATGTTTTCTGTCACACAATCAATGCGCTGTAAACTTAAA
GAAGACGCCACTTCTAACACTTAATTTATTAAGCATTAAATACATATGTT
AGAGATTTTTTTAAAAGCGGAATTGTTCTAGCTTTCCTTGATTACCAGTT
AAATGTCTGAAATAAGTTGATTAATTCCAATACATAAAAATCAAATTTTC
CGCCACAAAAAAAAAAAAAAAAAA

FI02812.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9117-RA 913 CG9117-RA 1..906 1..906 4530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6036048..6036953 906..1 4530 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6036997..6037902 906..1 4530 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6036997..6037902 906..1 4530 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:23:30 has no hits.

FI02812.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:24:20 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6036048..6036953 1..906 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:25 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..687 88..774 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:19 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..687 88..774 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:37 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..687 88..774 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:46:31 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..687 88..774 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:29:51 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..687 88..774 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:55 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:19 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:37 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 11:07:12 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:29:51 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
CG9117-RA 1..906 1..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:20 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6036997..6037902 1..906 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:20 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6036997..6037902 1..906 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:24:20 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6036997..6037902 1..906 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:37 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6036997..6037902 1..906 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:19 Download gff for FI02812.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6036997..6037902 1..906 100   Minus

FI02812.hyp Sequence

Translation from 87 to 773

> FI02812.hyp
MAYTDPAQRNQVTVLQVGYSRQEEGDESAMRANCTCTLVRCRDGTNIIVD
TLTAWDGDHLRSLLGQQGLGVDDIHVVVCSHGHSDHIGCNYLFQKARMHL
VGACASHHDLYMDHLGSGNPDEQLALDSNAEVVVRRSPGHTLSCVSVLVE
NSQLGGRVGITGDLFERREDIDDENIWMDAGSENEKVQREERSKMAQLCE
FIIPGHGPMFSVTQSMRCKLKEDATSNT*

FI02812.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9117-PA 228 CG9117-PA 1..228 1..228 1215 100 Plus

FI02812.pep Sequence

Translation from 87 to 773

> FI02812.pep
MAYTDPAQRNQVTVLQVGYSRQEEGDESAMRANCTCTLVRCRDGTNIIVD
TLTAWDGDHLRSLLGQQGLGVDDIHVVVCSHGHSDHIGCNYLFQKARMHL
VGACASHHDLYMDHLGSGNPDEQLALDSNAEVVVRRSPGHTLSCVSVLVE
NSQLGGRVGITGDLFERREDIDDENIWMDAGSENEKVQREERSKMAQLCE
FIIPGHGPMFSVTQSMRCKLKEDATSNT*

FI02812.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15411-PA 225 GF15411-PA 1..221 1..221 883 72.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10144-PA 230 GG10144-PA 1..228 1..228 1132 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10941-PA 216 GH10941-PA 6..209 10..221 745 63.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9117-PA 228 CG9117-PA 1..228 1..228 1215 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13553-PA 210 GI13553-PA 3..208 9..221 718 62.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19085-PA 224 GL19085-PA 2..221 4..224 863 71.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21555-PA 224 GA21555-PA 2..221 4..224 863 71.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17968-PA 228 GM17968-PA 1..228 1..228 1142 92.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22606-PA 228 GD22606-PA 1..228 1..228 1159 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12195-PA 213 GJ12195-PA 3..207 9..221 739 63.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15398-PA 225 GK15398-PA 8..221 10..223 861 69.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18954-PA 228 GE18954-PA 1..227 1..227 1129 91.2 Plus