Clone FI02825 Report

Search the DGRC for FI02825

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:25
Vector:pFlc-1
Associated Gene/TranscriptVhaM9.7-b-RA
Protein status:FI02825.pep: gold
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
VhaM9.7-2 2008-08-15 Release 5.9 accounting
VhaM9.7-2 2008-12-18 5.12 accounting

Clone Sequence Records

FI02825.complete Sequence

721 bp assembled on 2008-07-24

GenBank Submission: BT032649

> FI02825.complete
ACTGCTGCATGGGACATGTCCGTCATGTGATATTCGTTGCTCGAGAAAAA
GTTCGGTGATCGCTTTGTCCACCTTTTTATTTTTTATTTGCCCAAAGCAC
TTTGCGTCGATCCTAGAGCCTGCAAAATGGTATCCGAGTGGGTGGCACCA
ATCGTTATCACCAGCATTTGGGCCTTCATTGGCATCATCTGCCCCTTCTT
CGCCCGAGGACCCAACAGGGGGGTGACTCAATGCTGCCTGATGCTCACCG
CAGCAACTTGCTGGCTGTTCTGGCTGTGCTGCTACATGACGCAGCTGAAC
CCCCTCATCGGACCCAAACTAAGCATGAACGAAATCATGATCATGGCCCG
CGAGTGGGGCAATGAGATCAAGGACACCATGGCTGTCACCGTCTAATGTC
TGTCACCCTAATGTATTCGTTTCAATTGTTTTGTTATTGTTTCTTTATCC
CGGATTTTCCGACATTCTGTATTATTAATATCCACTTATTGTTCGAAGCA
TAAAATAAATTGTAACCGCGGTCGCTCTTGGCAAACACGTTGTAGAAAAT
CATAGATAAACAACATATTTTTATGCTTTGTACGCGCAAAGATGTAAACT
TAACGTTGCCTTTTTGGCCAAGCATTCCCAATAATCGAGTGTCTTAAAAT
GAAGATTGAAACCTAAAATAAAGTATATTTACACAATTCTGTGTTCAATA
AAAAAACAAAAAAAAAAAAAA

FI02825.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9_7-2.a 1322 VhaM9_7-2.a 107..807 1..701 3505 100 Plus
VhaM9_7-2-RA 1014 VhaM9_7-2-RA 107..807 1..701 3505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21529204..21529635 270..701 2160 100 Plus
chr3RHet 2517486 chr3RHet 1942001..1942306 396..701 1185 93.8 Plus
chr3L 24539361 chr3L 21528797..21529018 1..222 1110 100 Plus
chr3L 24539361 chr3L 21529087..21529135 221..269 245 100 Plus
chr3RHet 2517486 chr3RHet 1941969..1942012 347..390 220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21540269..21540700 270..701 2160 100 Plus
3R 32079331 3R 3579949..3580254 701..396 1185 93.8 Minus
3L 28110227 3L 21539862..21540083 1..222 1110 100 Plus
3L 28110227 3L 21540152..21540200 221..269 245 100 Plus
3R 32079331 3R 3580243..3580286 390..347 220 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21533369..21533800 270..701 2160 100 Plus
3R 31820162 3R 3241387..3241692 701..396 1205 93.8 Minus
3L 28103327 3L 21532962..21533183 1..222 1110 100 Plus
3L 28103327 3L 21533252..21533300 221..269 245 100 Plus
3R 31820162 3R 3241681..3241724 390..347 220 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:56:40 has no hits.

FI02825.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:57:54 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21528797..21529017 1..221 100 -> Plus
chr3L 21529088..21529135 222..269 100 -> Plus
chr3L 21529204..21529640 270..707 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:49 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-2-RA 1..270 127..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:29 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 1..270 127..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:32:04 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 1..270 127..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:22 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-2-RA 1..270 127..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:18 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 1..270 127..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:36 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-2-RA 1..705 1..705 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:29 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 17..715 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:32:04 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RB 1..706 1..707 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:27 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-2-RA 1..705 1..705 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:18 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RB 1..706 1..707 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:54 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21539862..21540082 1..221 100 -> Plus
3L 21540153..21540200 222..269 100 -> Plus
3L 21540269..21540705 270..707 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:54 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21539862..21540082 1..221 100 -> Plus
3L 21540153..21540200 222..269 100 -> Plus
3L 21540269..21540705 270..707 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:54 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21539862..21540082 1..221 100 -> Plus
3L 21540153..21540200 222..269 100 -> Plus
3L 21540269..21540705 270..707 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:32:04 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21532962..21533182 1..221 100 -> Plus
arm_3L 21533253..21533300 222..269 100 -> Plus
arm_3L 21533369..21533805 270..707 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:14 Download gff for FI02825.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21532962..21533182 1..221 100 -> Plus
3L 21533253..21533300 222..269 100 -> Plus
3L 21533369..21533805 270..707 99   Plus

FI02825.pep Sequence

Translation from 126 to 395

> FI02825.pep
MVSEWVAPIVITSIWAFIGIICPFFARGPNRGVTQCCLMLTAATCWLFWL
CCYMTQLNPLIGPKLSMNEIMIMAREWGNEIKDTMAVTV*

FI02825.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23725-PA 89 GF23725-PA 1..89 1..89 433 93.3 Plus
Dana\GF20098-PA 85 GF20098-PA 9..82 9..81 219 54.1 Plus
Dana\GF20059-PA 83 GF20059-PA 8..81 9..81 195 44.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16199-PA 89 GG16199-PA 1..88 1..88 457 98.9 Plus
Dere\GG15212-PA 85 GG15212-PA 9..82 9..81 205 50 Plus
Dere\GG14211-PA 84 GG14211-PA 8..83 9..83 197 48.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14789-PA 89 GH14789-PA 1..87 1..87 410 87.4 Plus
Dgri\GH15548-PA 92 GH15548-PA 9..84 9..83 216 53.9 Plus
Dgri\GH15937-PA 85 GH15937-PA 9..84 9..83 210 47.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-b-PB 89 CG7625-PB 1..89 1..89 492 100 Plus
VhaM9.7-b-PA 89 CG7625-PA 1..89 1..89 492 100 Plus
VhaM9.7-a-PC 85 CG1268-PC 9..82 9..81 226 50 Plus
VhaM9.7-a-PB 85 CG1268-PB 9..82 9..81 226 50 Plus
VhaM9.7-c-PA 84 CG11589-PA 8..83 9..83 214 48.7 Plus
VhaM9.7-d-PA 88 CG14909-PA 5..81 6..81 141 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes122-PA 89 GI11843-PA 1..87 1..87 411 87.4 Plus
Dmoj\GI16589-PA 85 GI16589-PA 9..84 9..83 210 48.7 Plus
Dmoj\GI16823-PA 85 GI16823-PA 5..84 6..83 206 55 Plus
Dmoj\GI21410-PA 85 GI21410-PA 5..84 6..83 206 55 Plus
Dmoj\GI23846-PA 88 GI23846-PA 2..80 3..80 145 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11891-PA 90 GL11891-PA 3..90 2..89 411 87.5 Plus
Dper\GL12843-PA 85 GL12843-PA 9..84 9..83 203 48.7 Plus
Dper\GL12731-PA 84 GL12731-PA 8..83 9..83 181 39.5 Plus
Dper\GL24534-PA 88 GL24534-PA 2..81 3..81 141 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20488-PA 90 GA20488-PA 3..90 2..89 411 87.5 Plus
Dpse\GA11753-PA 85 GA11753-PA 9..84 9..83 203 48.7 Plus
Dpse\GA11084-PA 84 GA11084-PA 8..83 9..83 181 39.5 Plus
Dpse\GA13345-PA 88 GA13345-PA 2..80 3..80 142 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22381-PA 89 GM22381-PA 1..89 1..89 461 100 Plus
Dsec\GM14641-PA 85 GM14641-PA 9..82 9..81 205 50 Plus
Dsec\GM14003-PA 84 GM14003-PA 8..83 9..83 202 50 Plus
Dsec\GM15188-PA 88 GM15188-PA 2..81 3..81 133 36.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14971-PA 89 GD14971-PA 1..89 1..89 461 100 Plus
Dsim\GD13283-PA 84 GD13283-PA 8..83 9..83 204 50 Plus
Dsim\GD19123-PA 88 GD19123-PA 2..81 3..81 133 36.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13542-PA 89 GJ13542-PA 1..87 1..87 388 82.8 Plus
Dvir\GJ12841-PA 85 GJ12841-PA 9..84 9..83 214 48.7 Plus
Dvir\GJ12571-PA 85 GJ12571-PA 9..84 9..83 213 55.3 Plus
Dvir\GJ10560-PA 88 GJ10560-PA 8..77 9..77 127 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17834-PA 89 GK17834-PA 1..89 1..89 413 86.5 Plus
Dwil\GK19005-PA 85 GK19005-PA 9..84 9..83 204 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19771-PA 89 GE19771-PA 1..89 1..89 461 100 Plus
Dyak\GE19768-PA 89 GE19768-PA 1..89 1..89 461 100 Plus
Dyak\GE21432-PA 85 GE21432-PA 9..82 9..81 205 50 Plus
Dyak\GE20639-PA 84 GE20639-PA 8..83 9..83 197 48.7 Plus

FI02825.hyp Sequence

Translation from 126 to 395

> FI02825.hyp
MVSEWVAPIVITSIWAFIGIICPFFARGPNRGVTQCCLMLTAATCWLFWL
CCYMTQLNPLIGPKLSMNEIMIMAREWGNEIKDTMAVTV*

FI02825.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-b-PB 89 CG7625-PB 1..89 1..89 492 100 Plus
VhaM9.7-b-PA 89 CG7625-PA 1..89 1..89 492 100 Plus
VhaM9.7-a-PC 85 CG1268-PC 9..82 9..81 226 50 Plus
VhaM9.7-a-PB 85 CG1268-PB 9..82 9..81 226 50 Plus
VhaM9.7-c-PA 84 CG11589-PA 8..83 9..83 214 48.7 Plus