Clone FI02827 Report

Search the DGRC for FI02827

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:27
Vector:pFlc-1
Associated Gene/TranscriptCG9240-RA
Protein status:FI02827.pep: gold
Sequenced Size:892

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9240 2008-08-15 Release 5.9 accounting
CG9240 2008-12-18 5.12 accounting

Clone Sequence Records

FI02827.complete Sequence

892 bp assembled on 2008-07-31

GenBank Submission: BT032650

> FI02827.complete
GCCTGTGCAGCCCTGATTTTTACACAACATAAACATTCGATTTTGGAGGA
GCTCTTTTTTCGAGAGAATACCAGGTCGTTGGACACGGGAGATGCTCTGA
TTAGGGGCGCATGTGGAGCAGCCAACGCCGGAATCGCCGACATGAAAATC
CTCTCCCGTCTGGGTCGCCTGATGCGCTACACGGTGGCCTACGCGGCAAT
CACACACTGCACCTTCGAGTACATTGGCGATTTCGTCCTGTGCAAAGGAC
CCTCCATGGAGCCCACCCTGCACTCGGACAACGTTCTTCTCACCGAGCGC
TTGTCGAAACACTGGCGAACCTACCAGCCCGGCGACATAGTCATCGCCAT
ATCGCCCATCAAAGCCGATCAGTTCATTTGCAAGCGTATCGTGGCCGTTT
CCGGTGATCAGGTGCTAATCCAGAAGCCCATTCCCATTGAGGCGGAGTTT
AGTGGTAATTCGGATGACAAGAAGAAGCCCGTGATGGTCAAGGACTATGT
GCCGCGCGGACACGTTTGGATTGAGGGTGACAACAAGGGAAACAGCTCGG
ATTCCCGCTACTACGGACCCATTCCGGTGGGCCTCATCCGGAGCCGCGTG
CTCTGCCGCATCTGGCCGATATCCGAGGCCACGGGTCTATAGATGGCATT
CGTACAACAAAGAGTTTAAAATCAACTTGACCCAATAAATGGCCTATGTT
TCGTTTGGAAATTATAGTACATCAAACCACAACTTTTTAGAATCATTACG
TATGCGAGTTTCGTCTCATTTGTGCGACTTCTGGTTTTTGCATATCATTG
AAAATAAGTTGAAAAAAACAGGAGAGAATAATAATTTCTTTTCATTTTTG
TTTTTAATAAACATATTTTTCAAAGTAAAAAAAAAAAAAAAA

FI02827.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9240-RA 1032 CG9240-RA 150..1026 1..877 4385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15589989..15590629 876..236 3190 99.8 Minus
chrX 22417052 chrX 15590806..15591045 240..1 1200 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15700171..15700812 877..236 3195 99.8 Minus
X 23542271 X 15700989..15701228 240..1 1200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15708269..15708910 877..236 3195 99.8 Minus
X 23527363 X 15709087..15709326 240..1 1200 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:35:03 has no hits.

FI02827.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:35:43 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15589989..15590624 241..876 100 <- Minus
chrX 15590806..15591045 1..240 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:40:51 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 1..501 142..642 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:14 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 1..501 142..642 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:29:53 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 1..501 142..642 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:17 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 1..501 142..642 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:41:15 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 1..501 142..642 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:48 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 150..1025 1..876 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:14 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 150..1025 1..876 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:29:53 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 32..907 1..876 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 11:06:58 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 150..1025 1..876 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:41:15 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
CG9240-RA 32..907 1..876 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:43 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
X 15700172..15700807 241..876 100 <- Minus
X 15700989..15701228 1..240 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:43 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
X 15700172..15700807 241..876 100 <- Minus
X 15700989..15701228 1..240 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:43 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
X 15700172..15700807 241..876 100 <- Minus
X 15700989..15701228 1..240 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:29:53 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15594205..15594840 241..876 100 <- Minus
arm_X 15595022..15595261 1..240 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:14 Download gff for FI02827.complete
Subject Subject Range Query Range Percent Splice Strand
X 15708270..15708905 241..876 100 <- Minus
X 15709087..15709326 1..240 100   Minus

FI02827.hyp Sequence

Translation from 0 to 641

> FI02827.hyp
ACAALIFTQHKHSILEELFFRENTRSLDTGDALIRGACGAANAGIADMKI
LSRLGRLMRYTVAYAAITHCTFEYIGDFVLCKGPSMEPTLHSDNVLLTER
LSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEF
SGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVGLIRSRV
LCRIWPISEATGL*

FI02827.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9240-PA 166 CG9240-PA 1..166 48..213 879 100 Plus
CG9240-PB 128 CG9240-PB 1..128 86..213 678 100 Plus
CG11110-PA 171 CG11110-PA 4..142 56..206 169 33.1 Plus

FI02827.pep Sequence

Translation from 0 to 641

> FI02827.pep
ACAALIFTQHKHSILEELFFRENTRSLDTGDALIRGACGAANAGIADMKI
LSRLGRLMRYTVAYAAITHCTFEYIGDFVLCKGPSMEPTLHSDNVLLTER
LSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEF
SGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVGLIRSRV
LCRIWPISEATGL*

FI02827.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22243-PA 152 GF22243-PA 1..151 48..199 674 83.6 Plus
Dana\GF12188-PA 171 GF12188-PA 4..142 56..206 163 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19383-PA 167 GG19383-PA 1..163 48..210 831 93.3 Plus
Dere\GG22048-PA 171 GG22048-PA 4..142 56..206 170 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17636-PA 167 GH17636-PA 5..167 50..213 650 73.8 Plus
Dgri\GH21989-PA 169 GH21989-PA 24..142 75..206 158 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9240-PA 166 CG9240-PA 1..166 48..213 879 100 Plus
CG9240-PB 128 CG9240-PB 1..128 86..213 678 100 Plus
CG11110-PA 171 CG11110-PA 4..142 56..206 169 33.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16074-PA 170 GI16074-PA 9..170 50..213 659 73.8 Plus
Dmoj\GI19690-PA 169 GI19690-PA 24..142 75..206 160 34.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16525-PA 160 GL16525-PA 7..158 53..212 597 67.5 Plus
Dper\GL17039-PA 169 GL17039-PA 21..142 72..206 172 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21635-PA 160 GA21635-PA 7..158 53..212 592 67.5 Plus
Dpse\GA10765-PA 169 GA10765-PA 21..142 72..206 171 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22538-PA 166 GM22538-PA 1..166 48..213 859 96.4 Plus
Dsec\GM22032-PA 171 GM22032-PA 4..142 56..206 170 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15786-PA 166 GD15786-PA 1..166 48..213 869 97 Plus
Dsim\GD11530-PA 171 GD11530-PA 4..142 56..206 174 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15719-PA 170 GJ15719-PA 9..170 50..213 651 73.8 Plus
Dvir\GJ17277-PA 169 GJ17277-PA 24..142 75..206 161 34.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15998-PA 177 GK15998-PA 1..177 48..213 669 68.9 Plus
Dwil\GK21711-PA 169 GK21711-PA 3..142 54..206 164 32.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16031-PA 166 GE16031-PA 1..166 48..213 853 94.6 Plus
Dyak\GE12129-PA 171 GE12129-PA 4..142 56..206 171 33.1 Plus