Clone FI02845 Report

Search the DGRC for FI02845

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:45
Vector:pFlc-1
Associated Gene/TranscriptSmD1-RA
Protein status:FI02845.pep: gold
Sequenced Size:742

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
snRNP69D 2008-08-15 Release 5.9 accounting
snRNP69D 2008-12-18 5.12 accounting

Clone Sequence Records

FI02845.complete Sequence

742 bp assembled on 2008-07-28

GenBank Submission: BT032651

> FI02845.complete
AGTTTACCGCAACCACCAAATTCCAAGTAAACTAGCCGGCATTGTTTGTG
CGCGTTTTTTTTTGCAGAAAACCACCAAAAACACATAAAAACATGAAATT
AGTAAGATTCCTTATGAAGCTAAGTCACGAGACCGTGACCATCGAACTGA
AGAACGGCACCCAGATCCACGGCACCATTACCGGCGTGGATGTGGCCATG
AACACTCACCTGAAGAGCGTTCGGATGACGATCAAGAACCGGGATCCCGT
CCACCTGGAGACGCTGAGCATTCGCGGCAACAACATCAGATACTTTATAC
TGCCGGACAGCCTGCCGCTGGAGACGCTCCTCATCGACGACACCCCGAAG
TCGAAGACAAAAAAGAAGGACAGCGGCCGCGTGGGAAATCGCGGCAGGGG
CAGAGGCGCCCGCGGACGAGGTGGTCCACGGGGTCGCGGAAGGGGCCGAG
CTTCAGGCCGACGTTAATCTTTGTAACAGCTACATCTAATAAACAATATT
CGATAAATATAGAATATAAATATTCTTTGGATAAATCCACACTGTATGCA
TTTACTATGTACGAACAACTGACAAATGTCTTCAGCTAGTAAAGAAACTC
CATCTGAATATGTATATTGTTAAAAATCACTCTGTGTAGTAGCTCAGGAA
AAATGTGTTTACTTGGCAACAAATTGAAAGAAGACTCCCGCCATTAAATT
ATGATTAAAAATGTTTGAAAGTTTGTAAAAAAAAAAAAAAAA

FI02845.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
snRNP69D-RA 845 snRNP69D-RA 115..845 1..731 3640 99.8 Plus
snRNP69D.a 822 snRNP69D.a 92..822 1..731 3640 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12723750..12724371 726..105 3080 99.7 Minus
chr3L 24539361 chr3L 12724889..12724993 106..1 465 98.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12733359..12733985 731..105 3135 100 Minus
3L 28110227 3L 12734503..12734608 106..1 515 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12726459..12727085 731..105 3135 100 Minus
3L 28103327 3L 12727603..12727708 106..1 515 99 Minus
Blast to na_te.dros performed 2019-03-16 16:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 3026..3064 724..686 114 76.9 Minus

FI02845.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:45:32 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12723750..12724369 107..726 99 <- Minus
chr3L 12724889..12724993 1..106 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:05 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP69D-RA 1..375 93..467 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:12 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 1..375 93..467 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:53 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 1..375 93..467 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:43 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP69D-RA 1..375 93..467 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:40:07 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 1..375 93..467 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:29 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP69D-RA 1..726 1..726 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:12 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 1..726 1..726 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:53 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 4..729 1..726 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:29 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
snRNP69D-RA 1..726 1..726 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:40:07 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 4..729 1..726 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:32 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12733364..12733983 107..726 100 <- Minus
3L 12734503..12734608 1..106 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:32 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12733364..12733983 107..726 100 <- Minus
3L 12734503..12734608 1..106 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:32 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12733364..12733983 107..726 100 <- Minus
3L 12734503..12734608 1..106 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:53 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12727603..12727708 1..106 99   Minus
arm_3L 12726464..12727083 107..726 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:32 Download gff for FI02845.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12726464..12727083 107..726 100 <- Minus
3L 12727603..12727708 1..106 99   Minus

FI02845.hyp Sequence

Translation from 92 to 466

> FI02845.hyp
MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNR
DPVHLETLSIRGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNR
GRGRGARGRGGPRGRGRGRASGRR*

FI02845.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
SmD1-PA 124 CG10753-PA 1..124 1..124 637 100 Plus
SmD3-PA 151 CG8427-PA 7..121 8..118 139 32.5 Plus

FI02845.pep Sequence

Translation from 92 to 466

> FI02845.pep
MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNR
DPVHLETLSIRGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNR
GRGRGARGRGGPRGRGRGRASGRR*

FI02845.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25112-PA 124 GF25112-PA 1..124 1..124 624 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13810-PA 124 GG13810-PA 1..124 1..124 619 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14721-PA 124 GH14721-PA 1..113 1..113 423 95.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
SmD1-PA 124 CG10753-PA 1..124 1..124 637 100 Plus
SmD3-PA 151 CG8427-PA 7..121 8..118 139 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12268-PA 124 GI12268-PA 1..113 1..113 417 95.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24936-PA 118 GL24936-PA 1..106 8..113 427 99.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10544-PA 125 GA10544-PA 1..113 1..113 464 99.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24635-PA 124 GM24635-PA 1..124 1..124 624 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12704-PA 124 GD12704-PA 1..124 1..124 624 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11498-PA 80 GJ11498-PA 1..69 45..113 195 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18761-PA 124 GK18761-PA 1..94 1..94 471 95.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20102-PA 124 GE20102-PA 1..124 1..124 624 100 Plus