Clone FI02846 Report

Search the DGRC for FI02846

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:46
Vector:pFlc-1
Associated Gene/TranscriptTwdlB-RA
Protein status:FI02846.pep: gold
Sequenced Size:1048

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
TwdlB 2008-12-18 5.12 accounting

Clone Sequence Records

FI02846.complete Sequence

1048 bp assembled on 2008-11-07

GenBank Submission: BT044113.1

> FI02846.complete
TTTGGACACAAGCAACTCATACCTCAAAGCGAAAGAACCAGCAATCTGCT
TAAGATGCGCGCATTCATTGTCCTGTGTTTGGTGGCAGTCACCTGCGCCG
ATAAGCTCGGCTACAACTACCAGCCCGTTGGCCACTCCAGCTCCGGACTG
TCCTTCGCTCCTGGCAGCGGCTCTATCAGTGGTGGATCTATTGGAGGAGG
CTCCATCGGAGGAGGTTCTATTGGAGGAGGCTCTATTGGAGGAGGCCTCA
TTGGTGGTGGCTCTATCGGAGGAGGAAGCATCGGAGGTGGATCCCTTGGT
GGTTCCATCGGTGGTGGCTCCATCGATTCCGGTCTTGGCGGTCTTGGTGG
ACTCGGTGGTCTAGGAGGTGGCGACGCTCTGGCCGCTCCAGTCTCCTACA
ACGCCCCCGCTCCCGCTGCTGAGCTCCAGAAGGAATTCTTCACCTACTCC
GCCAACGAGCAGGACTTCGATGAGCCACAAGAACTGGAGCGTGTTGCTGG
ATCCGTAAACAAGGGACTGCGCGTTGTCTTCATCAAGGGACCCGAGAACC
GTGGTCTGGAGAACGCTGCCCTGGCCCTCGCCAAGCAGGCTGCCCAGCAG
GAGACCGCCATCTATGTCCTGAACAAGCAGGCTGATATTGGAGATCTTGC
CCAGAAACTGAACGCCATCCGCAACAACAACAACAACAAGCCCGAGGTGC
ACTTCGTCAAGTACCGCACTCCCGAGGATGCTGCCAACGCCCAGCGCGCC
ATCCAGGGTCAGTACGACCAGCTGGGAGGATCCTCTCAGGCTCATGATGG
TGGTGTTGCACCCGCCCTGAACTTCGCCTCCGCTGGACCCGTCCAGAAGG
CTAACGCCCAGATCCCCGACAACGCCTACCTGCCCACTTCTGTGTTCCGT
CGTCTGCGTTTCTAGGAAGGCTACATCTTGGACTCCATTAACTTAAGCAA
ATCTCGACTGAAGAACTCATTCTTCCTGTTACACGTTGTTGACTAATGCA
TAATTACACCAATAAATTTGAAATTTAAATACAAAAAAAAAAAAAAAA

FI02846.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlB-RA 1070 TwdlB-RA 40..1067 5..1032 5125 99.9 Plus
TwdlL-RA 1252 TwdlL-RA 287..1139 52..904 3395 93.2 Plus
TwdlL-RB 1073 TwdlL-RB 140..964 80..904 3345 93.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22445572..22446534 1032..70 4635 98.8 Minus
chr3R 27901430 chr3R 22447807..22448631 904..80 3345 93.7 Minus
chr3R 27901430 chr3R 22455438..22455964 384..910 1735 88.6 Plus
chr3R 27901430 chr3R 22442689..22443224 367..902 1675 87.5 Plus
chr3R 27901430 chr3R 22453335..22453736 430..831 1170 86.1 Plus
chr3R 27901430 chr3R 22451165..22451566 831..430 1095 84.8 Minus
chr3R 27901430 chr3R 22457202..22457566 421..785 865 82.5 Plus
chr3R 27901430 chr3R 22449224..22449564 842..502 820 82.7 Minus
chr3R 27901430 chr3R 22442384..22442583 74..273 445 81.5 Plus
chr3R 27901430 chr3R 22443921..22444184 783..520 435 77.7 Minus
chr3R 27901430 chr3R 22455043..22455161 52..170 400 89.1 Plus
chr3R 27901430 chr3R 22446597..22446663 71..5 305 97 Minus
chr3R 27901430 chr3R 22463651..22463845 580..774 300 76.9 Plus
chr3R 27901430 chr3R 22480059..22480166 529..636 300 85.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26622446..26623413 1037..70 4825 99.9 Minus
3R 32079331 3R 26624689..26625513 904..80 3345 93.7 Minus
3R 32079331 3R 26632323..26632849 384..910 1750 88.8 Plus
3R 32079331 3R 26619592..26620103 391..902 1630 87.9 Plus
3R 32079331 3R 26630220..26630621 430..831 1185 86.3 Plus
3R 32079331 3R 26628051..26628458 831..424 1170 85.8 Minus
3R 32079331 3R 26634088..26634452 421..785 850 82.2 Plus
3R 32079331 3R 26626108..26626448 842..502 820 82.7 Minus
3R 32079331 3R 26619263..26619462 74..273 445 81.5 Plus
3R 32079331 3R 26620800..26621063 783..520 435 77.7 Minus
3R 32079331 3R 26631928..26632046 52..170 400 89.1 Plus
3R 32079331 3R 26623480..26623546 71..5 320 98.5 Minus
3R 32079331 3R 26656956..26657063 529..636 300 85.2 Plus
3R 32079331 3R 26640530..26640720 580..770 295 77 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26363277..26364244 1037..70 4825 99.8 Minus
3R 31820162 3R 26365520..26366344 904..80 3345 93.6 Minus
3R 31820162 3R 26373154..26373680 384..910 1750 88.8 Plus
3R 31820162 3R 26360540..26360865 508..833 1315 93.5 Plus
3R 31820162 3R 26371124..26371452 503..831 1180 90.5 Plus
3R 31820162 3R 26368882..26369210 831..503 1135 89.6 Minus
3R 31820162 3R 26375006..26375283 508..785 820 86.3 Plus
3R 31820162 3R 26366998..26367279 783..502 810 85.8 Minus
3R 31820162 3R 26360094..26360293 74..273 445 81.5 Plus
3R 31820162 3R 26361631..26361894 783..520 435 77.6 Minus
3R 31820162 3R 26372759..26372877 52..170 400 89 Plus
3R 31820162 3R 26364311..26364377 71..5 320 98.5 Minus
3R 31820162 3R 26397787..26397894 529..636 300 85.1 Plus
3R 31820162 3R 26360423..26360526 391..494 295 85.5 Plus
3R 31820162 3R 26381465..26381551 684..770 240 85 Plus
3R 31820162 3R 26360195..26360292 190..287 175 78.5 Plus
3R 31820162 3R 26360194..26360313 204..323 165 75.8 Plus
3R 31820162 3R 26381361..26381411 580..630 165 88.2 Plus
3R 31820162 3R 26374919..26374975 421..477 150 84.2 Plus
3R 31820162 3R 26397945..26398014 687..756 140 80 Plus
Blast to na_te.dros performed 2019-03-16 17:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 7802..7847 156..201 113 71.7 Plus

FI02846.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:19:27 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22445572..22446534 70..1032 98 <- Minus
chr3R 22446599..22446663 1..69 91   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:07 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..861 55..915 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:40 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..861 55..915 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:17 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..861 55..915 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:17:45 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..861 55..915 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:56:24 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..861 55..915 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:34 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..1030 4..1032 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:40 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..1030 4..1032 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:17 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..1025 8..1032 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 10:24:35 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..1030 4..1032 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:56:24 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
TwdlB-RA 1..1025 8..1032 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:19:27 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26622451..26623413 70..1032 100 <- Minus
3R 26623482..26623546 1..69 92   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:19:27 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26622451..26623413 70..1032 100 <- Minus
3R 26623482..26623546 1..69 92   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:19:27 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26622451..26623413 70..1032 100 <- Minus
3R 26623482..26623546 1..69 92   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:17 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22448173..22449135 70..1032 100 <- Minus
arm_3R 22449204..22449268 1..69 92   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:02 Download gff for FI02846.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26363282..26364244 70..1032 100 <- Minus
3R 26364313..26364377 1..69 92   Minus

FI02846.pep Sequence

Translation from 0 to 914

> FI02846.pep
FGHKQLIPQSERTSNLLKMRAFIVLCLVAVTCADKLGYNYQPVGHSSSGL
SFAPGSGSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLG
GSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFTYS
ANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQ
ETAIYVLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRA
IQGQYDQLGGSSQAHDGGVAPALNFASAGPVQKANAQIPDNAYLPTSVFR
RLRF*

FI02846.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18576-PA 281 GF18576-PA 102..281 125..304 825 93.3 Plus
Dana\GF16443-PA 276 GF16443-PA 1..276 19..302 783 65.3 Plus
Dana\GF18575-PA 289 GF18575-PA 111..287 125..301 761 90.4 Plus
Dana\GF16445-PA 295 GF16445-PA 116..293 127..304 702 81.5 Plus
Dana\GF18573-PA 246 GF18573-PA 1..246 19..304 686 59.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11490-PA 285 GG11490-PA 1..283 19..304 902 74.9 Plus
Dere\GG12182-PA 288 GG12182-PA 109..288 125..304 792 93.3 Plus
Dere\GG12181-PA 282 GG12181-PA 109..280 130..301 772 92.4 Plus
Dere\GG12179-PA 239 GG12179-PA 1..238 19..303 751 58.7 Plus
Dere\GG11487-PA 286 GG11487-PA 109..286 125..302 742 87.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18879-PA 271 GH18879-PA 1..270 19..303 876 72.3 Plus
Dgri\GH18876-PA 232 GH18876-PA 1..232 19..304 835 60.5 Plus
Dgri\GH18724-PA 308 GH18724-PA 135..308 129..302 758 87.4 Plus
Dgri\GH18878-PA 312 GH18878-PA 139..312 129..302 753 85.6 Plus
Dgri\GH18726-PA 286 GH18726-PA 1..286 19..304 700 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlB-PA 286 CG6478-PA 1..286 19..304 1466 100 Plus
TwdlL-PA 285 CG6447-PA 1..283 19..301 1424 97.5 Plus
TwdlL-PB 279 CG6447-PB 1..277 25..301 1396 97.5 Plus
TwdlM-PA 288 CG5468-PA 1..288 19..302 1243 84.1 Plus
TwdlN-PA 309 CG5476-PA 1..307 19..304 1090 74 Plus
TwdlK-PA 247 CG6460-PA 1..246 19..303 746 58.4 Plus
TwdlJ-PB 274 CG5471-PB 1..274 19..304 727 55.7 Plus
Tb-PA 283 CG5480-PA 1..233 19..287 616 50.7 Plus
TwdlO-PA 229 CG6452-PA 10..227 94..303 606 57.8 Plus
TwdlH-PA 241 CG31080-PA 62..238 125..300 606 69.5 Plus
TwdlP-PA 220 CG14240-PA 8..219 93..303 601 58.7 Plus
TwdlD-PA 256 CG14243-PA 1..239 19..298 559 47 Plus
TwdlQ-PA 245 CG14250-PA 69..243 136..300 430 52.6 Plus
TwdlT-PA 286 CG5812-PA 1..251 19..267 294 33.8 Plus
TwdlX-PA 346 CG32571-PA 57..274 39..271 285 33.1 Plus
TwdlR-PA 325 CG31081-PA 66..199 140..275 284 43.8 Plus
Twdlalpha-PA 388 CG32574-PA 1..301 19..272 278 32 Plus
TwdlW-PA 308 CG4060-PA 131..257 144..271 257 48.8 Plus
TwdlG-PC 278 CG14643-PC 143..276 171..298 245 42.6 Plus
TwdlG-PB 278 CG14643-PB 143..276 171..298 245 42.6 Plus
TwdlG-PA 278 CG14643-PA 143..276 171..298 245 42.6 Plus
TwdlY-PA 247 CG32570-PA 34..243 89..296 241 34.7 Plus
TwdlF-PA 354 CG14639-PA 137..305 140..298 236 36.3 Plus
TwdlV-PA 251 CG14640-PA 1..210 19..278 235 29.9 Plus
TwdlS-PA 228 CG14242-PA 39..169 134..265 194 37.8 Plus
TwdlZ-PB 210 CG32569-PB 27..165 136..271 183 35 Plus
CG17108-PA 342 CG17108-PA 52..155 35..124 177 45.4 Plus
CG17108-PA 342 CG17108-PA 104..191 44..124 175 53.3 Plus
Cpr47Ef-PD 601 CG13214-PD 7..174 23..188 173 36 Plus
Cpr47Ef-PC 612 CG13214-PC 7..174 23..188 173 36 Plus
CG17108-PA 342 CG17108-PA 151..247 44..124 170 50.5 Plus
CG17108-PA 342 CG17108-PA 122..202 44..132 168 52.8 Plus
CG13376-PB 200 CG13376-PB 1..111 19..124 162 45.2 Plus
CG17108-PA 342 CG17108-PA 138..236 44..124 161 48.5 Plus
Cpr47Ef-PD 601 CG13214-PD 237..323 37..124 161 46.6 Plus
Cpr47Ef-PC 612 CG13214-PC 237..323 37..124 161 46.6 Plus
CG10598-PC 173 CG10598-PC 17..123 43..142 161 40.2 Plus
CG10598-PA 173 CG10598-PA 17..123 43..142 161 40.2 Plus
Cpr47Ef-PD 601 CG13214-PD 226..314 46..124 160 46.7 Plus
Cpr47Ef-PD 601 CG13214-PD 345..437 44..136 160 44.4 Plus
Cpr47Ef-PC 612 CG13214-PC 226..314 46..124 160 46.7 Plus
Cpr47Ef-PC 612 CG13214-PC 345..437 44..136 160 44.4 Plus
CG14191-PA 193 CG14191-PA 3..120 23..124 160 42 Plus
CG13376-PD 204 CG13376-PD 1..115 17..124 160 43.6 Plus
Cpr47Ef-PC 612 CG13214-PC 421..513 44..129 157 44.1 Plus
CG17108-PA 342 CG17108-PA 214..294 44..124 156 50 Plus
Cpr47Ef-PD 601 CG13214-PD 310..400 44..132 156 52.1 Plus
Cpr47Ef-PC 612 CG13214-PC 310..400 44..132 156 52.1 Plus
CG11458-PA 98 CG11458-PA 26..95 55..124 155 51.4 Plus
CG15140-PB 335 CG15140-PB 179..248 55..123 155 42.9 Plus
CG17108-PA 342 CG17108-PA 1..127 19..124 154 40 Plus
Cpr47Ef-PD 601 CG13214-PD 424..528 44..137 153 42.5 Plus
CG17108-PA 342 CG17108-PA 217..336 37..139 152 42.3 Plus
CG13376-PC 193 CG13376-PC 15..104 44..124 151 48.9 Plus
CG15140-PB 335 CG15140-PB 169..250 55..134 151 38.6 Plus
CG13376-PC 193 CG13376-PC 3..93 43..124 146 48.9 Plus
CG5172-PD 172 CG5172-PD 9..102 22..125 146 43.9 Plus
CG7294-PA 127 CG7294-PA 1..120 19..137 145 37.1 Plus
CG11458-PA 98 CG11458-PA 19..85 58..124 142 50.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24735-PA 315 GI24735-PA 1..315 19..302 863 67.9 Plus
Dmoj\GI22877-PA 300 GI22877-PA 127..300 129..302 764 87.9 Plus
Dmoj\GI24736-PA 280 GI24736-PA 1..279 19..303 758 68.9 Plus
Dmoj\GI22879-PA 308 GI22879-PA 134..308 130..304 706 82.9 Plus
Dmoj\GI22878-PA 277 GI22878-PA 1..276 16..303 625 49.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23099-PA 284 GL23099-PA 1..284 19..302 918 83.1 Plus
Dper\GL24442-PA 293 GL24442-PA 118..293 129..304 791 92 Plus
Dper\GL24441-PA 288 GL24441-PA 113..288 129..304 788 91.5 Plus
Dper\GL23101-PA 316 GL23101-PA 140..314 130..304 759 88.6 Plus
Dper\GL23102-PA 264 GL23102-PA 1..262 19..301 717 54.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27140-PB 264 GA27140-PB 1..264 19..302 814 69.7 Plus
Dpse\GA26615-PA 293 GA26615-PA 118..293 129..304 791 92 Plus
Dpse\GA26614-PB 296 GA26614-PB 121..296 129..304 784 90.9 Plus
Dpse\GA18910-PA 316 GA18910-PA 140..314 130..304 759 88.6 Plus
Dpse\GA26613-PA 250 GA26613-PA 1..250 19..304 722 59.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10178-PA 286 GM10178-PA 1..286 19..304 1406 97.2 Plus
Dsec\GM10177-PA 290 GM10177-PA 1..288 19..301 966 93.1 Plus
Dsec\GM10330-PA 265 GM10330-PA 1..265 19..302 780 69 Plus
Dsec\GM10332-PA 280 GM10332-PA 103..278 129..304 770 89.8 Plus
Dsec\GM10175-PA 247 GM10175-PA 1..247 19..304 697 58.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18130-PA 286 GD18130-PA 1..286 19..304 1419 97.9 Plus
Dsim\GD21291-PA 275 GD21291-PA 1..275 19..302 868 71.5 Plus
Dsim\GD21293-PA 309 GD21293-PA 132..307 129..304 770 89.8 Plus
Dsim\GD18127-PA 247 GD18127-PA 1..247 19..304 697 59 Plus
Dsim\GD21292-PA 274 GD21292-PA 1..274 19..304 657 54.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14563-PA 289 GJ14563-PA 113..289 126..302 819 84.7 Plus
Dvir\GJ14171-PA 265 GJ14171-PA 92..265 129..302 747 85.6 Plus
Dvir\GJ14564-PA 262 GJ14564-PA 87..262 129..304 746 86.4 Plus
Dvir\GJ14173-PA 284 GJ14173-PA 1..284 19..304 700 50.2 Plus
Dvir\GJ14174-PA 245 GJ14174-PA 1..243 19..304 682 53.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13320-PA 284 GK13320-PA 1..284 19..302 854 70.1 Plus
Dwil\GK13963-PA 283 GK13963-PA 106..283 127..304 768 88.2 Plus
Dwil\GK13962-PA 279 GK13962-PA 103..277 127..301 731 84 Plus
Dwil\GK13322-PA 298 GK13322-PA 119..296 127..304 725 82 Plus
Dwil\GK13959-PA 262 GK13959-PA 1..262 19..304 682 60.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10626-PA 276 GE10626-PA 1..276 19..304 965 93.7 Plus
Dyak\GE23678-PA 284 GE23678-PA 1..284 19..302 886 77.5 Plus
Dyak\GE10625-PA 280 GE10625-PA 102..278 125..301 785 93.8 Plus
Dyak\GE23680-PA 302 GE23680-PA 123..300 127..304 777 88.8 Plus
Dyak\GE10623-PA 247 GE10623-PA 1..247 19..304 689 59 Plus

FI02846.hyp Sequence

Translation from 6 to 914

> FI02846.hyp
HKQLIPQSKRTSNLLKMRAFIVLCLVAVTCADKLGYNYQPVGHSSSGLSF
APGSGSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGS
IGGGSIDSGLGGLGGLGGLGGGDALAAPVSYNAPAPAAELQKEFFTYSAN
EQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALAKQAAQQET
AIYVLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQ
GQYDQLGGSSQAHDGGVAPALNFASAGPVQKANAQIPDNAYLPTSVFRRL
RF*

FI02846.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
TwdlB-PA 286 CG6478-PA 1..286 17..302 1466 100 Plus
TwdlL-PA 285 CG6447-PA 1..283 17..299 1424 97.5 Plus
TwdlL-PB 279 CG6447-PB 1..277 23..299 1396 97.5 Plus
TwdlM-PA 288 CG5468-PA 1..288 17..300 1243 84.1 Plus
TwdlN-PA 309 CG5476-PA 1..307 17..302 1090 74 Plus