Clone FI02850 Report

Search the DGRC for FI02850

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:50
Vector:pFlc-1
Associated Gene/TranscriptRpL34a-RA
Protein status:FI02850.pep: gold
Sequenced Size:618

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
RpL34a 2008-08-15 Release 5.9 accounting
RpL34a 2008-12-18 5.12 accounting

Clone Sequence Records

FI02850.complete Sequence

618 bp assembled on 2008-07-25

GenBank Submission: BT032652

> FI02850.complete
TCTTCTTCCTTCTTTTGATTTCCGGAGAGAAGCTTTAAAATGGTCCAACG
CTTGACTCTGAGACGACGTCTGTCGTACAACACCCGCTCCAACAAGAGGC
GCATTGTGCGCACTCCCGGAGGCCGTCTGGTGTACCAGTACGTGAAGAAG
AACCCCACTGTGCCACGCTGTGGTCAGTGCAAGGAGAAACTCCACGGGAT
CACCCCCTCCCGGCCCAGCGAGCGTCCCAGGATGTCCAAGCGTTTGAAGA
CCGTCTCCAGGACCTACGGAGGTGTCCTGTGCCACAGCTGCCTGCGAGAG
AGAATCGTCCGCGCTTTCCTCATCGAAGAGCAGAAGATCGTCAAGGCTCT
GAAGAGCCAGCGCGAGGCTTTGGTCAAGCCCGTCAAGAAGGTTGTGGAGA
AGAAGCCGGTGAAGGCTGCCGCCAAGAAGCCCGCGGGAAAGGCAGCCGGA
AAGCCAGGTGCCAAAGTCGCCGGCAAGAAGCCCGCTCCCAAGGGCGCTCC
TAAAGGAGTCGTCAAGTCCAAGAAGTAACCATTTACCAGAAGGATTTGTT
TGGAGCAATGATATTGAACACCTTTTTTTTGTAATAAAGAAACCACAAAT
CGAAAAAAAAAAAAAAAA

FI02850.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
RpL34a-RA 672 RpL34a-RA 5..612 1..608 3010 99.6 Plus
RpL34a-RC 705 RpL34a-RC 41..645 1..608 2940 99.1 Plus
RpL34a-RB 638 RpL34a-RB 49..627 30..608 2865 99.6 Plus
RpL34a-RB 638 RpL34a-RB 5..33 1..29 145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21881408..21881903 600..105 2480 100 Minus
chr3R 27901430 chr3R 5226429..5226711 387..105 830 86.2 Minus
chr3R 27901430 chr3R 21881966..21882042 104..28 385 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26058414..26058917 608..105 2490 99.6 Minus
3R 32079331 3R 9400596..9400878 387..105 830 86.2 Minus
3R 32079331 3R 26058980..26059056 104..28 385 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25799245..25799748 608..105 2490 99.6 Minus
3R 31820162 3R 9141427..9141709 387..105 830 86.2 Minus
3R 31820162 3R 25799811..25799887 104..28 385 100 Minus
3R 31820162 3R 9141773..9141840 104..37 175 83.8 Minus
3R 31820162 3R 25800066..25800094 29..1 145 100 Minus
Blast to na_te.dros performed 2019-03-15 18:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy6 7826 gypsy6 GYPSY6 7826bp 1445..1520 358..429 118 65.8 Plus

FI02850.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:40:18 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21881406..21881903 105..602 99 <- Minus
chr3R 21881966..21882040 30..104 100 <- Minus
chr3R 21882223..21882251 1..29 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:10 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RB 1..489 40..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:59 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RC 1..489 40..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:26:19 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 1..489 40..528 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:49 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RB 1..489 40..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:03 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 1..489 40..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:23 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 1..602 1..602 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:59 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 5..606 1..602 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:26:19 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 5..606 1..602 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:13 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 1..602 1..602 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:03 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34a-RA 5..606 1..602 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:18 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26058420..26058917 105..602 99 <- Minus
3R 26058980..26059054 30..104 100 <- Minus
3R 26059235..26059263 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:18 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26058420..26058917 105..602 99 <- Minus
3R 26058980..26059054 30..104 100 <- Minus
3R 26059235..26059263 1..29 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:40:18 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26058420..26058917 105..602 99 <- Minus
3R 26058980..26059054 30..104 100 <- Minus
3R 26059235..26059263 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:26:19 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21884142..21884639 105..602 99 <- Minus
arm_3R 21884702..21884776 30..104 100 <- Minus
arm_3R 21884957..21884985 1..29 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:55 Download gff for FI02850.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25799251..25799748 105..602 99 <- Minus
3R 25799811..25799885 30..104 100 <- Minus
3R 25800066..25800094 1..29 100   Minus

FI02850.hyp Sequence

Translation from 39 to 527

> FI02850.hyp
MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEK
LHGITPSRPSERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI
VKALKSQREALVKPVKKVVEKKPVKAAAKKPAGKAAGKPGAKVAGKKPAP
KGAPKGVVKSKK*

FI02850.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL34a-PC 162 CG6090-PC 1..162 1..162 827 100 Plus
RpL34a-PB 162 CG6090-PB 1..162 1..162 827 100 Plus
RpL34a-PA 162 CG6090-PA 1..162 1..162 827 100 Plus
RpL34b-PD 168 CG9354-PD 1..162 1..153 618 82.7 Plus
RpL34b-PC 168 CG9354-PC 1..162 1..153 618 82.7 Plus

FI02850.pep Sequence

Translation from 39 to 527

> FI02850.pep
MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEK
LHGITPSRPSERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI
VKALKSQREALVKPVKKVVEKKPVKAAAKKPAGKAAGKPGAKVAGKKPAP
KGAPKGVVKSKK*

FI02850.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17768-PA 167 GF17768-PA 1..115 1..115 554 94.8 Plus
Dana\GF18218-PA 157 GF18218-PA 1..110 1..110 529 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12199-PA 162 GG12199-PA 1..162 1..162 784 96.9 Plus
Dere\GG17378-PA 168 GG17378-PA 1..115 1..115 583 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18140-PA 158 GH18140-PA 1..155 1..155 580 85.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
RpL34a-PC 162 CG6090-PC 1..162 1..162 827 100 Plus
RpL34a-PB 162 CG6090-PB 1..162 1..162 827 100 Plus
RpL34a-PA 162 CG6090-PA 1..162 1..162 827 100 Plus
RpL34b-PD 168 CG9354-PD 1..162 1..153 618 82.7 Plus
RpL34b-PC 168 CG9354-PC 1..162 1..153 618 82.7 Plus
RpL34b-PA 168 CG9354-PA 1..162 1..153 618 82.7 Plus
RpL34b-PB 168 CG9354-PB 1..162 1..153 618 82.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22901-PA 158 GI22901-PA 1..158 1..162 617 84.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22011-PA 159 GL22011-PA 1..159 1..162 638 89.6 Plus
Dper\GL13673-PA 170 GL13673-PA 1..116 1..116 573 96.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27345-PA 159 GA27345-PA 1..159 1..162 638 89.6 Plus
Dpse\GA26986-PA 170 GA26986-PA 1..116 1..116 573 96.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10197-PA 162 GM10197-PA 1..162 1..162 797 98.8 Plus
Dsec\GM23916-PA 130 GM23916-PA 1..115 1..115 578 98.3 Plus
Dsec\GM26264-PA 164 GM26264-PA 1..111 1..115 507 89.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18147-PA 162 GD18147-PA 1..162 1..162 800 99.4 Plus
Dsim\GD20801-PA 168 GD20801-PA 1..115 1..115 580 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23314-PA 158 GJ23314-PA 1..158 1..162 622 85.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12799-PA 165 GK12799-PA 1..165 1..162 602 82.1 Plus
Dwil\GK12136-PA 171 GK12136-PA 1..115 1..115 558 95.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10642-PA 162 GE10642-PA 1..162 1..162 786 96.9 Plus
Dyak\GE24782-PA 168 GE24782-PA 1..115 1..115 585 99.1 Plus