Clone FI02852 Report

Search the DGRC for FI02852

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:28
Well:52
Vector:pFlc-1
Associated Gene/Transcriptcrok-RA
Protein status:FI02852.pep: gold
Sequenced Size:1046

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17218 2008-08-15 Release 5.9 accounting
CG17218 2008-12-18 5.12 accounting

Clone Sequence Records

FI02852.complete Sequence

1046 bp assembled on 2008-07-08

GenBank Submission: BT044115.1

> FI02852.complete
AACGCTGCTCACACGGTCACACTGCTATTTACACGCCCAAAAAAATTGAA
TCCAATTGAAACGCGAAGAAAAACATAAATATAACGATGAAAACACTGGA
GAAATATATCCTATTCGCCATCGTGCTCTGCTGCCTGCTGCAATTGGGCC
AGGCGATCAAATGTTGGGACTGTCGCAGCGATAACGATCCCAAATGCGGG
GATCCTTTTGACAACAGCACGCTGGCCATCACCGATTGCCAACAGGCGCC
GGAGCTGGAGCATCTGAAGGGCGTGCGACCGACAATGTGTCGCAAGATCC
GGCAGAAGGTGCACGGTGAATGGCGCTACTTTCGCAGCTGCGCCTACATG
GGCGAGCCGGGCATCGAGGGCGACGAACGCTTCTGCCTGATGCGCACTGG
CAGCTACAACATCTTCATGGAGTTCTGCACGTGCAACAGCAAGGACGGCT
GCAACTCGGCGGGCATCCATAGGCTAGGACTGATGGGCGTCCTAACTGGC
ACACTGCTCTCGGTGATTGTGGCTCATCTTCTGCGGCAATAGGTGGATCC
ACCTGCTTCAGCTGTAGCCAATGCCACGCCCCATTTGCCACAAGGCTGAT
CAGATAGTATAAACTGTATTAGCATGCTTGCTTGTGTGTTCAACGTAGAT
ATAAAAACTGAAGAATTCTATAATTGTAACCGAGATATTTAGCAAATATT
TTTAAAATTTGTAAATTACCTTAATTAGCAGTAACTTACCTGACGCGCGA
ACAGTCTTGTGGTGAATGAGCGATGTGTAATCAAGTGCCTTTTCTGTAAC
GGACTCGTATTGTAACTTAAGCCTGGAATACTATTTCCGTCCAAAAAATA
TCTTACGCCTATGACATTCCATCTCGTAAACTGAATCTTGTAATACTTTC
TATTTTCTACATTTATTTTGTAATGTTTTTGCGAAAGATCGCCTAGTTTT
AGTCGACTTACAAGTTTTTATTGTAATGCGATGTCAAATAGAACATTTTT
GAATAATTAAAAAAAAAAACGGTTATACACAAAAAAAAAAAAAAAA

FI02852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17218-RA 1089 CG17218-RA 54..1083 1..1030 5150 100 Plus
CG17218.a 1543 CG17218.a 54..1083 1..1030 5150 100 Plus
CG17218-RB 1024 CG17218-RB 1..1024 1..1029 5045 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12171862..12172745 147..1030 4405 99.9 Plus
chr2L 23010047 chr2L 12171638..12171785 1..148 740 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:08:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173208..12174091 147..1030 4420 100 Plus
2L 23513712 2L 12172984..12173131 1..148 740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173208..12174091 147..1030 4420 100 Plus
2L 23513712 2L 12172984..12173131 1..148 740 100 Plus
Blast to na_te.dros performed 2019-03-16 06:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
mdg3 5519 mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). 5000..5062 924..864 121 68.3 Minus

FI02852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:11:44 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12171638..12171784 1..147 100 -> Plus
chr2L 12171863..12172745 148..1030 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:41:11 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 1..456 87..542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:14 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 1..456 87..542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:31:16 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 1..456 87..542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:52:35 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 1..456 87..542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:10 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 1..456 87..542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:07 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 1..1030 1..1030 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:14 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 1..1030 1..1030 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:31:16 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 4..1033 1..1030 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:52:35 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 1..1030 1..1030 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:10 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 4..1033 1..1030 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:44 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12172984..12173130 1..147 100 -> Plus
2L 12173209..12174091 148..1030 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:44 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12172984..12173130 1..147 100 -> Plus
2L 12173209..12174091 148..1030 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:11:44 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12172984..12173130 1..147 100 -> Plus
2L 12173209..12174091 148..1030 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:31:16 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12172984..12173130 1..147 100 -> Plus
arm_2L 12173209..12174091 148..1030 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:33:49 Download gff for FI02852.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12173209..12174091 148..1030 100   Plus
2L 12172984..12173130 1..147 100 -> Plus

FI02852.hyp Sequence

Translation from 86 to 541

> FI02852.hyp
MKTLEKYILFAIVLCCLLQLGQAIKCWDCRSDNDPKCGDPFDNSTLAITD
CQQAPELEHLKGVRPTMCRKIRQKVHGEWRYFRSCAYMGEPGIEGDERFC
LMRTGSYNIFMEFCTCNSKDGCNSAGIHRLGLMGVLTGTLLSVIVAHLLR
Q*

FI02852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
crok-PA 151 CG17218-PA 1..151 1..151 831 100 Plus
CG6329-PF 155 CG6329-PF 5..122 4..125 255 39.8 Plus
CG6329-PE 155 CG6329-PE 5..122 4..125 255 39.8 Plus
CG6329-PD 155 CG6329-PD 5..122 4..125 255 39.8 Plus
CG6329-PB 155 CG6329-PB 5..122 4..125 255 39.8 Plus

FI02852.pep Sequence

Translation from 86 to 541

> FI02852.pep
MKTLEKYILFAIVLCCLLQLGQAIKCWDCRSDNDPKCGDPFDNSTLAITD
CQQAPELEHLKGVRPTMCRKIRQKVHGEWRYFRSCAYMGEPGIEGDERFC
LMRTGSYNIFMEFCTCNSKDGCNSAGIHRLGLMGVLTGTLLSVIVAHLLR
Q*

FI02852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14191-PA 151 GF14191-PA 1..151 1..151 735 87.4 Plus
Dana\GF13713-PA 155 GF13713-PA 5..122 4..125 246 39.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23775-PA 151 GG23775-PA 1..151 1..151 750 91.4 Plus
Dere\GG20404-PA 155 GG20404-PA 5..123 4..126 241 39.5 Plus
Dere\GG23454-PA 147 GG23454-PA 5..141 7..143 136 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11641-PA 151 GH11641-PA 1..151 1..151 659 78.1 Plus
Dgri\GH21037-PA 155 GH21037-PA 5..151 4..150 254 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
crok-PA 151 CG17218-PA 1..151 1..151 831 100 Plus
CG6329-PF 155 CG6329-PF 5..122 4..125 255 39.8 Plus
CG6329-PE 155 CG6329-PE 5..122 4..125 255 39.8 Plus
CG6329-PD 155 CG6329-PD 5..122 4..125 255 39.8 Plus
CG6329-PB 155 CG6329-PB 5..122 4..125 255 39.8 Plus
CG6329-PC 155 CG6329-PC 5..122 4..125 255 39.8 Plus
CG6329-PA 155 CG6329-PA 5..122 4..125 255 39.8 Plus
CG7781-PB 147 CG7781-PB 5..140 7..142 146 32.7 Plus
CG7781-PA 147 CG7781-PA 5..140 7..142 146 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17943-PA 151 GI17943-PA 1..151 1..151 676 80.8 Plus
Dmoj\GI18639-PA 154 GI18639-PA 5..150 4..150 237 32 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18618-PA 151 GL18618-PA 1..151 1..151 663 86.1 Plus
Dper\GL17476-PA 155 GL17476-PA 18..120 18..123 212 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14397-PA 151 GA14397-PA 1..151 1..151 663 86.1 Plus
Dpse\GA19515-PA 155 GA19515-PA 18..120 18..123 212 38.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26756-PA 128 GM26756-PA 17..128 40..151 576 96.4 Plus
Dsec\GM21492-PA 155 GM21492-PA 5..123 4..126 244 39.5 Plus
Dsec\GM13045-PA 147 GM13045-PA 5..141 7..143 136 32.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23827-PA 151 GD23827-PA 1..151 1..151 792 98 Plus
Dsim\GD10986-PA 155 GD10986-PA 5..123 4..126 244 39.5 Plus
Dsim\GD22419-PA 147 GD22419-PA 5..141 7..143 136 32.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17714-PA 151 GJ17714-PA 1..151 1..151 684 84.1 Plus
Dvir\GJ21652-PA 154 GJ21652-PA 5..150 4..150 251 34 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15491-PA 151 GK15491-PA 1..151 1..151 666 82.1 Plus
Dwil\GK17859-PA 150 GK17859-PA 19..124 19..124 206 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18579-PA 151 GE18579-PA 1..151 1..151 782 95.4 Plus
Dyak\GE12564-PA 157 GE12564-PA 5..123 4..126 244 39.5 Plus
Dyak\GE11043-PA 147 GE11043-PA 5..141 7..143 136 32.4 Plus